• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated PRX5 Monoclonal antibody

PRX5 Monoclonal Antibody for IF/ICC
Cat No. CL488-67599
Clone No.1B8C5

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

IF/ICC

Peroxiredoxin 5, PRDX5, B166, AOPP, AOEB166

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67599 targets PRX5 in IF/ICC applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12262

Product name: Recombinant human Prx5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-214 aa of BC110983

Sequence: MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL

Predict reactive species
Full Name peroxiredoxin 5
Calculated Molecular Weight 214 aa, 22 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC110983
Gene Symbol PRX5
Gene ID (NCBI) 25824
RRIDAB_3672954
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP30044
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Peroxiredoxin 5 (Prx5) is a member of a family consisting of six antioxidant enzymes. Prx5 is ubiquitously expressed in various tissues including mitochondria and peroxisomes, implying that Prx5 functions as a regulator of the cellular oxidation state. Prx5 plays a critical role in protecting cells from oxidative stress by inhibiting the accumulation of reactive oxygen species and cell death. Prx5 has an intensive ROS scavenging activity because it is located in the cytosol and mitochondria. Prx5 expression was upregulated during adipogenesis and Prx5 overexpression suppressed adipogenesis by regulating cytosolic and mitochondrial ROS generation. (PMID: 29777756, PMID: 31505325, PMID: 22020876)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PRX5 antibody CL488-67599Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...