PSAT1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PSAT1 Polyclonal antibody (10501-1-AP)

• Featured Product
• KD/KO Validated

PSAT1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10501-1-AP

Publications(114)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

EC:2.6.1.52, EPIP, Phosphoserine aminotransferase, PSA, PSAT

• 

  WB analysis using 10501-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10501-1-AP (PSAT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10501-1-AP

  WB result of PSAT1 antibody (10501-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PSAT1 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10501-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10501-1-AP (PSAT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 10501-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10501-1-AP (PSAT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 10501-1-AP

  IP result of anti-PSAT1 (IP:10501-1-AP, 3ug; Detection:10501-1-AP 1:300) with HeLa cells lysate 2480ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 10501-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10501-1-AP (PSAT1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10501-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10501-1-AP (PSAT1 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10501-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10501-1-AP (PSAT1 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10501-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PSAT1 antibody (10501-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10501-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PSAT1 antibody (10501-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 10501-1-AP

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug PSAT1 Polyclonal antibody (10501-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, HEK-293 cells, HepG2 cells, K-562 cells, rat brain tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human pancreas cancer tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10501-1-AP targets PSAT1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0776

  Product name: Recombinant human PSAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-370 aa of BC004863

  Sequence: MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

• Full Name: phosphoserine aminotransferase 1
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC004863
• Gene Symbol: PSAT1
• Gene ID (NCBI): 29968
• RRID: AB_2172597
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y617
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSAT1, also named PSA and PSAT, belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family and SerC subfamily. It catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. PSAT1 represents a new interesting target for CRC therapy. (PMID:18221502) It may be implicated in altered serine metabolism and schizophrenia spectrum conditions. (PMID:20955740)

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; Stem cell function and stress response are controlled by protein synthesis.; Authors - Sandra Blanco
human	WB	Cell Metab; Serine metabolism antagonizes antiviral innate immunity by preventing ATP6V0d2-mediated YAP lysosomal degradation.; Authors - Long Shen
mouse	WB	Nat Immunol; PERK is a critical metabolic hub for immunosuppressive function in macrophages.; Authors - Lydia N Raines
mouse	WB	Cell Metab; PMID: 28111214; Authors - Eric H Ma
human	WB	Nat Commun; Phosphoglycerate dehydrogenase activates PKM2 to phosphorylate histone H3T11 and attenuate cellular senescence; Authors - Yinsheng Wu
human	WB	Nat Chem Biol; PSAT1 impairs ferroptosis and reduces immunotherapy efficacy via GPX4 hydroxylation; Authors - Peixiang Zheng