CoraLite® Plus 488-conjugated PSAT1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated PSAT1 Polyclonal antibody (CL488-10501)

• Featured Product
• KD/KO Validated

PSAT1 Polyclonal Antibody for FC (Intra)

Cat No. CL488-10501 Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IF, FC (Intra)

Synonyms

EC:2.6.1.52, EPIP, Phosphoserine aminotransferase, PSA, PSAT

• 

  FC experiment of HepG2 using CL488-10501

  1X10^6 HepG2 cells were intracellularly stained with 0.8 ug CoraLite® Plus 488 Anti-Human PSAT1 (CL488-10501) (red), or 0.8 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PSAT1 in ?

Chat with Able

---

Tested Applications

• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10501 targets PSAT1 in IF, FC (Intra) applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0776

  Product name: Recombinant human PSAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-370 aa of BC004863

  Sequence: MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

• Full Name: phosphoserine aminotransferase 1
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC004863
• Gene Symbol: PSAT1
• Gene ID (NCBI): 29968
• RRID: AB_3672446
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y617
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

PSAT1, also named PSA and PSAT, belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family and SerC subfamily. It catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. PSAT1 represents a new interesting target for CRC therapy. (PMID:18221502) It may be implicated in altered serine metabolism and schizophrenia spectrum conditions. (PMID:20955740)

Publications

What published studies show

The CoraLite® Plus 488-conjugated PSAT1 Polyclonal antibody (CL488-10501) has 1 citation. It appears in Nature Chemical Biology (2025), in a study investigating how PSAT1 impairs ferroptosis and reduces immunotherapy efficacy via GPX4 hydroxylation. The associated research fields include ferroptosis, cancer immunotherapy, and redox biology. The antibody was used for immunofluorescence (IF) in this publication.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Nat Chem Biol; PSAT1 impairs ferroptosis and reduces immunotherapy efficacy via GPX4 hydroxylation; Authors - Peixiang Zheng