CoraLite® Plus 488-conjugated PSIP1 Recombinant monoclonal antibody

PSIP1 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-85395
Clone No.242841C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

242841C5, CLL associated antigen KW 7, CLL-associated antigen KW-7, DFS70, LEDGF

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85395 targets PSIP1 in applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag21886

Product name: Recombinant human PSIP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 104-324 aa of BC064135

Sequence: ASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDITTPKAARRGRKRKAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETEHQTTCNLQ

Predict reactive species
Full Name PC4 and SFRS1 interacting protein 1
Calculated Molecular Weight 530 aa, 60 kDa
Observed Molecular Weight75 kDa
GenBank Accession NumberBC064135
Gene Symbol PSIP1
Gene ID (NCBI) 11168
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75475
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PSIP1, also known as PC4 and SRSF1 Interacting Protein 1 or Lens Epithelium-Derived Growth Factor (LEDGF), is a transcriptional coactivator involved in neuroepithelial stem cell differentiation and neurogenesis. It also plays a role in lens epithelial cell gene regulation and stress responses. It is a chromatin-associated protein with histone chaperone activity, involved in transcriptional elongation. PSIP1 may act as an adapter to coordinate pre-mRNA splicing. PSIP1 encodes two protein isoforms with molecular masses of 52 and 75 kDa. p52 and p75 were identified as interacting with transcription factor PC4 and shown to act as transcriptional coactivators.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PSIP1 antibody CL488-85395Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...