CoraLite® Plus 488-conjugated PSMA/GCPII Recombinant monoclonal antibody

PSMA/GCPII Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-84615-2
Clone No.242026F4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

FOLH1, PSMA, Cell growth-inhibiting gene 27 protein, EC:3.4.17.21, FGCP

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inLNCaP cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84615-2 targets PSMA/GCPII in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0216

Product name: Recombinant Human PSMA/GCPII protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: N-6*His

Domain: 44-750 aa of NM_004476.3

Sequence: KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA

Predict reactive species
Full Name folate hydrolase (prostate-specific membrane antigen) 1
Calculated Molecular Weight84KD
Observed Molecular Weight100 kDa
GenBank Accession NumberNM_004476.3
Gene Symbol PSMA
Gene ID (NCBI) 2346
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ04609
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Prostate-specific membrane antigen (PSMA), also known as glutamate carboxypeptidase II (GCPII), is a type II transmembrane glycoprotein that has gained significant attention in the field of prostate cancer (PCa) diagnostics and therapeutics. PSMA is highly overexpressed in prostate cancer tissue, especially in aggressive, androgen-deprived, metastatic, and hormone-refractory prostate cancers. Up to 95% of prostate adenocarcinomas express PSMA receptors on their surface. Physiological expression of PSMA is observed in normal prostate epithelium, duodenum, colon, renal tubules, and sympathetic ganglia. It is also found in other tissues such as the salivary glands, lacrimal glands, and various parts of the gastrointestinal tract, though at lower levels.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PSMA/GCPII antibody CL488-84615-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...