CoraLite® Plus 488-conjugated PSMA/GCPII Recombinant monoclonal antibody

• 

  IF Staining of LNCaP using CL488-84615-2

  Immunofluorescent analysis of (4% PFA) fixed LNCaP cells using CoraLite® Plus 488 PSMA/GCPII antibody (CL488-84615-2, Clone: 242026F4 ) at dilution of 1:200.

PSMA/GCPII Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84615-2

Clone No.242026F4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

FOLH1, PSMA, Cell growth-inhibiting gene 27 protein, EC:3.4.17.21, FGCP

---

Tested Applications

• Positive IF/ICC detected in: LNCaP cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84615-2 targets PSMA/GCPII in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0216

  Product name: Recombinant Human FOLH1 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: N-6*His

  Domain: 44-750 aa of NM_004476.3

  Sequence: KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA

• Full Name: folate hydrolase (prostate-specific membrane antigen) 1
• Calculated Molecular Weight: 84KD
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: NM_004476.3
• Gene Symbol: PSMA
• Gene ID (NCBI): 2346
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q04609
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Prostate-specific membrane antigen (PSMA), also known as glutamate carboxypeptidase II (GCPII), is a type II transmembrane glycoprotein that has gained significant attention in the field of prostate cancer (PCa) diagnostics and therapeutics. PSMA is highly overexpressed in prostate cancer tissue, especially in aggressive, androgen-deprived, metastatic, and hormone-refractory prostate cancers. Up to 95% of prostate adenocarcinomas express PSMA receptors on their surface. Physiological expression of PSMA is observed in normal prostate epithelium, duodenum, colon, renal tubules, and sympathetic ganglia. It is also found in other tissues such as the salivary glands, lacrimal glands, and various parts of the gastrointestinal tract, though at lower levels.