PSMA5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PSMA5 Polyclonal antibody, PBS Only (30580-1-PBS)

• 

  WB analysis using 30580-1-AP (same clone as 30580-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30580-1-AP (PSMA5 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30580-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 30580-1-AP (same clone as 30580-1-PBS)

  WB result of PSMA5 antibody (30580-1-AP; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PSMA5 transfected HepG2 cells. This data was developed using the same antibody clone with 30580-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 30580-1-AP (same clone as 30580-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30580-1-AP (PSMA5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30580-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 30580-1-AP (same clone as 30580-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PSMA5 antibody (30580-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 30580-1-PBS in a different storage buffer formulation.

PSMA5 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30580-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Proteasome subunit alpha type-5, PSC5, ZETA

---

Product Information

30580-1-PBS targets PSMA5 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30703

  Product name: Recombinant human PSMA5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 120-241 aa of NM_002790

  Sequence: ALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI

• Full Name: proteasome (prosome, macropain) subunit, alpha type, 5
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: NM_002790
• Gene Symbol: PSMA5
• Gene ID (NCBI): 5686
• RRID: AB_3086368
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P28066
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Proteasome subunit alpha type-5(PSMA5) is a component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. It binds to two 19S regulatory particles(RP) to form the 26S proteasome, an ATP-dependent multisubunit protease that degrades polyubiquitinated proteins into small peptides.(PMID: 26661102)