Tested Applications
| Positive WB detected in | MCF-7 cells, human brain tissue, HepG2 cells, HeLa cells, NIH/3T3 cells |
| Positive IHC detected in | human liver cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11749-1-AP targets PSMB1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2345 Product name: Recombinant human PSMB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-241 aa of BC020807 Sequence: MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD Predict reactive species |
| Full Name | proteasome (prosome, macropain) subunit, beta type, 1 |
| Calculated Molecular Weight | 241 aa, 26 kDa |
| Observed Molecular Weight | 25 kDa |
| GenBank Accession Number | BC020807 |
| Gene Symbol | PSMB1 |
| Gene ID (NCBI) | 5689 |
| RRID | AB_2284481 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P20618 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PSMB1(Proteasome subunit beta type-1) is also named as PSC5 and belongs to the peptidase T1B family. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The gene encodes a 241 amino acid protein with a 28 amino acid propeptide and two glycosylation sites.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for PSMB1 antibody 11749-1-AP | Download protocol |
| IF protocol for PSMB1 antibody 11749-1-AP | Download protocol |
| IHC protocol for PSMB1 antibody 11749-1-AP | Download protocol |
| WB protocol for PSMB1 antibody 11749-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PSMB1 Polyclonal antibody (Cat# 11749-1-AP) has 23 citations published in journals including Cell, Nature Neuroscience, Cell Death & Differentiation, Cancer Letters, Oncogene, EMBO Journal, PLoS Biology, and Phytomedicine. Research fields span proteasome biology, neurodegeneration (tau/Alzheimer's), oncology (myeloma, lung, breast, cholangiocarcinoma), cardiovascular hypertrophy, immunology, diabetes, proteostasis, autophagy, and ferroptosis. Applications include WB, IHC, and IF across human, mouse, rat, and other species.
| Species | Application | Title |
|---|---|---|
Cell Comprehensive human proteome profiles across a 50-year lifespan reveal aging trajectories and signatures | ||
Nat Neurosci Dendritic translation and neuroproteasome-mediated degradation of endogenous tau revealed by STARFISH. | ||
Nat Neurosci Neuroproteasomes regulate endogenous tau paired helical filament formation in an APOE genotype- and age-dependent manner. | ||
Cell Death Differ Quantitative reactive cysteinome profiling reveals a functional link between ferroptosis and proteasome-mediated degradation | ||
Cancer Lett Combinations of ivermectin with proteasome inhibitors induce synergistic lethality in multiple myeloma | ||
Phytomedicine PTEN status determines therapeutic vulnerability to celastrol in cholangiocarcinoma |
Reviews
What customers say
The product received a single 5-star review for Western Blot use at a 1:1000 dilution. The reviewer described the antibody as "specific to target," indicating strong binding performance and reliable results in their application. Overall, the feedback reflects satisfaction with the product's specificity and effectiveness.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Janelle (Verified Customer) (09-12-2022) | Specific to target
|
