CoraLite® Plus 488-conjugated PSMB1 Monoclonal antibody

PSMB1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67847
Clone No.1C7C5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

1C7C5, FLJ25321, HC5, KIAA1838, Macropain subunit C5

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67847 targets PSMB1 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30791

Product name: Recombinant human PSMB1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-241 aa of BC020807

Sequence: MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD

Predict reactive species
Full Name proteasome (prosome, macropain) subunit, beta type, 1
Calculated Molecular Weight 241 aa, 26 kDa
Observed Molecular Weight25 kDa
GenBank Accession NumberBC020807
Gene Symbol PSMB1
Gene ID (NCBI) 5689
RRIDAB_2923802
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP20618
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PSMB1(Proteasome subunit beta type-1) is also named as PSC5 and belongs to the peptidase T1B family. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The gene encodes a 241 amino acid protein with a 28 amino acid propeptide and two glycosylation sites.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 PSMB1 antibody CL488-67847Download protocol
IF protocol for CL Plus 488 PSMB1 antibody CL488-67847Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...