PSMB10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PSMB10 Polyclonal antibody, PBS Only (15976-1-PBS)

• 

  WB analysis using 15976-1-AP (same clone as 15976-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 15976-1-AP (PSMB10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15976-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 15976-1-AP (same clone as 15976-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 15976-1-AP (PSMB10 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15976-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 15976-1-AP (same clone as 15976-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15976-1-AP (PSMB10 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15976-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 15976-1-AP (same clone as 15976-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15976-1-AP (PSMB10 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15976-1-PBS in a different storage buffer formulation.

PSMB10 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15976-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15976-1-PBS targets PSMB10 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8764

  Product name: Recombinant human PSMB10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-273 aa of BC017198

  Sequence: MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE

• Full Name: proteasome (prosome, macropain) subunit, beta type, 10
• Calculated Molecular Weight: 273 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC017198
• Gene Symbol: PSMB10
• Gene ID (NCBI): 5699
• RRID: AB_2171872
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40306
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The proteasome subunit, beta type 10 (PSMB10) gene regulated by interferon-gamma is a core part of the 26S proteasome complex, which is an important protein degrading system. Study identifies immunosubunit PSMB10 as a novel regulator that contributes to Ang II-induced atrial fibrillation (AF) and suggests that inhibition of PSMB10 may represent a potential therapeutic target for treating hypertensive AF. (PMID: 29507100, PMID: 16965406)