PSMB10 Monoclonal antibody, PBS Only

• 

  WB analysis using 66403-1-Ig (same clone as 66403-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66403-1-Ig (PSMB10 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 66403-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 66403-1-Ig (same clone as 66403-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 66403-1-Ig (PSMB10 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66403-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat thymus using 66403-1-Ig (same clone as 66403-1-PBS)

  rat thymus tissue were subjected to SDS PAGE followed by western blot with 66403-1-Ig (PSMB10 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66403-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Ramos using 66403-1-Ig (same clone as 66403-1-PBS)

  Ramos cells were subjected to SDS PAGE followed by western blot with 66403-1-Ig (PSMB10 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66403-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 66403-1-Ig (same clone as 66403-1-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 66403-1-Ig (PSMB10 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66403-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human spleen using 66403-1-Ig (same clone as 66403-1-PBS)

  human spleen tissue were subjected to SDS PAGE followed by western blot with 66403-1-Ig (PSMB10 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66403-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig thymus using 66403-1-Ig (same clone as 66403-1-PBS)

  pig thymus tissue were subjected to SDS PAGE followed by western blot with 66403-1-Ig (PSMB10 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66403-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66403-1-Ig (same clone as 66403-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66403-1-Ig (PSMB10 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66403-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66403-1-Ig (same clone as 66403-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66403-1-Ig (PSMB10 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66403-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 66403-1-Ig (same clone as 66403-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66403-1-Ig (PSMB10 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66403-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 66403-1-Ig (same clone as 66403-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using PSMB10 antibody (66403-1-Ig, Clone: 1G8C1 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66403-1-PBS in a different storage buffer formulation.

PSMB10 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66403-1-PBS

Clone No.1G8C1

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Multicatalytic endopeptidase complex subunit MECl-1, MECL1, Macropain subunit MECl-1, LMP10, EC:3.4.25.1

---

Product Information

66403-1-PBS targets PSMB10 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8835

  Product name: Recombinant human PSMB10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-273 aa of BC017198

  Sequence: MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE

• Full Name: proteasome (prosome, macropain) subunit, beta type, 10
• Calculated Molecular Weight: 273 aa, 29 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC017198
• Gene Symbol: PSMB10
• Gene ID (NCBI): 5699
• RRID: AB_2881777
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P40306
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMB10(Proteasome subunit beta type-10) is also named as LMP10, MECL1.It belongs to the peptidase T1B family and is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.