CoraLite®594-conjugated PSMB8 Monoclonal antibody

PSMB8 Monoclonal Antibody for IF/ICC, IF-P, FC (Intra)

Cat No. CL594-66759
Clone No.2A5B6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC, IF-P, FC (Intra)

Proteasome subunit beta-5i, Proteasome subunit beta type-8, Proteasome subunit beta type 8, LMP7, EC:3.4.25.1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman liver cancer tissue
Positive IF/ICC detected inC2C12 cells, human liver cancer tissue, HeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66759 targets PSMB8 in IF/ICC, IF-P, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6780

Product name: Recombinant human PSMB8 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-272 aa of BC001114

Sequence: MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ

Predict reactive species
Full Name proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7)
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC001114
Gene Symbol PSMB8
Gene ID (NCBI) 5696
RRIDAB_2920031
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP28062
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PSMB8(Proteasome subunit beta type-8) is also named as LMP7, PSMB5i, RING10, Y2 and belongs to the peptidase T1B family. The gene encodes the chymotrypsin-like catalytic subunit of the immunoproteasome(PMID: 19525961). PSMB8 has a role in controlling pathogenic immune responses and may be a target in autoimmune disorders. Its prosequence is not essential for incorporation of PSMB8 into the maturing proteasome, but it increased the efficiency of PSMB8 incorporation and proteasome maturation(PMID: 10926487). The pro-PSMB8 is a 276aa protein with the molecular mass of 30 kDa, and the mature form is about 23kDa due to the 72aa propeptide cleaved. Defects in PSMB8 are the cause of Nakajo syndrome (NKJO).

Protocols

Product Specific Protocols
IF protocol for CL594 PSMB8 antibody CL594-66759Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...