Product Information
31201-1-PBS targets PSMG4 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35222 Product name: Recombinant human PSMG4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-123 aa of NM_001128591.1 Sequence: MEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF Predict reactive species |
| Full Name | proteasome (prosome, macropain) assembly chaperone 4 |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | NM_001128591.1 |
| Gene Symbol | PSMG4 |
| Gene ID (NCBI) | 389362 |
| RRID | AB_3669898 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q5JS54 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
PSMG4 (Proteasome assembly chaperone 4), also known as C6orf86. It is expected to be located in the nucleus and cytoplasm, which interacts with PSMG3 and asociates with alpha subunits of the 20S proteasome. The molecular weight of PSMG4 is 13 kDa.



