PSPH Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84899-5-RR (same clone as 84899-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84899-5-RR (PSPH antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84899-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84899-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84899-5-RR against Human PSPH were performed. The affinity constant is below 1 pM.

PSPH Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84899-5-PBS

Clone No.242518C4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

242518C4, EC:3.1.3.3, L-3-phosphoserine phosphatase, O-phosphoserine phosphohydrolase, PSP

---

Product Information

84899-5-PBS targets PSPH in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5972

  Product name: Recombinant human PSPH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-225 aa of BC063614

  Sequence: MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

• Full Name: phosphoserine phosphatase
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC063614
• Gene Symbol: PSPH
• Gene ID (NCBI): 5723
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P78330
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.