Use Able AI chat for product recommendations

PSPH Recombinant monoclonal antibody

PSPH Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 84899-5-RR
Clone No.242518C4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

242518C4, EC:3.1.3.3, L-3-phosphoserine phosphatase, O-phosphoserine phosphohydrolase, PSP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, MCF-7 cells, U-87 MG cells, HepG2 cells, NIH/3T3 cells, HSC-T6 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84899-5-RR targets PSPH in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5972

Product name: Recombinant human PSPH protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-225 aa of BC063614

Sequence: MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

Predict reactive species
Full Name phosphoserine phosphatase
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 25-28 kDa
GenBank Accession NumberBC063614
Gene Symbol PSPH
Gene ID (NCBI) 5723
RRIDAB_3743825
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP78330
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSPH (phosphoserine phosphatase) is an enzyme, which is involved in the process of L-serine biosynthesis. PSPH mainly plays role in multiple aspects of cell behaviours such as proliferation and differentiation by producing precursors for the biosynthesis of diverse compounds including neurotransmitters, glycolipids and thymidine (PMID: 11237721, PMID: 19963421). Additionally, augmented PSPH level is correlated with the prognosis in multiple cancers including cutaneous squamous cell carcinoma (PMID: 21726982), breast cancer (PMID: 28931725), non-small cell lung cancer (PMID: 30662358), colorectal cancer (PMID: 24146633) and hepatocellular carcinoma (PMID: 25793315).

Protocols

Product Specific Protocols
FC protocol for PSPH antibody 84899-5-RRDownload protocol
WB protocol for PSPH antibody 84899-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...