PSPH Recombinant monoclonal antibody

• 

  WB analysis using 84899-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84899-5-RR (PSPH antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of HepG2 using 84899-5-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug PSPH Recombinant monoclonal antibody (84899-5-RR, Clone:242518C4) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• 

  Affinity and Kinetic Characterization of 84899-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84899-5-RR against Human PSPH were performed. The affinity constant is below 1 pM.

PSPH Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 84899-5-RR

Clone No.242518C4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

Synonyms

242518C4, EC:3.1.3.3, L-3-phosphoserine phosphatase, O-phosphoserine phosphohydrolase, PSP

---

Tested Applications

• Positive WB detected in: A375 cells, MCF-7 cells, U-87 MG cells, HepG2 cells, NIH/3T3 cells, HSC-T6 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84899-5-RR targets PSPH in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5972

  Product name: Recombinant human PSPH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-225 aa of BC063614

  Sequence: MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

• Full Name: phosphoserine phosphatase
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC063614
• Gene Symbol: PSPH
• Gene ID (NCBI): 5723
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P78330
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSPH (phosphoserine phosphatase) is an enzyme, which is involved in the process of L-serine biosynthesis. PSPH mainly plays role in multiple aspects of cell behaviours such as proliferation and differentiation by producing precursors for the biosynthesis of diverse compounds including neurotransmitters, glycolipids and thymidine (PMID: 11237721, PMID: 19963421). Additionally, augmented PSPH level is correlated with the prognosis in multiple cancers including cutaneous squamous cell carcinoma (PMID: 21726982), breast cancer (PMID: 28931725), non-small cell lung cancer (PMID: 30662358), colorectal cancer (PMID: 24146633) and hepatocellular carcinoma (PMID: 25793315).