• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated PTPN1/PTP1B Recombinant monoclonal antibody

PTPN1/PTP1B Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-85905-4
Clone No.250215G6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

PTP1B, PTPN1, EC:3.1.3.48, Protein-tyrosine phosphatase 1B, PTP 1B

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inBxPC-3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85905-4 targets PTPN1/PTP1B in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1878

Product name: Recombinant human PTPN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-435 aa of BC015660

Sequence: MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT

Predict reactive species
Full Name protein tyrosine phosphatase, non-receptor type 1
Calculated Molecular Weight 435 aa, 50 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC015660
Gene Symbol PTP1B
Gene ID (NCBI) 5770
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP18031
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PTPN1 (protein tyrosine phosphatase, non-receptor type 1) is also named as PTP1B or PTP-1B, and belongs to the protein-tyrosine phosphatase family and non-receptor class 1 subfamily. PTPN1 is involved in the regulation of several important physiological pathways, which regulates both INS and leptin signaling, and interacts with the epidermal-and platelet-derived growth factor receptors (PMID: 20101100). The gene might harbor variants influencing susceptibility to INS resistance and type 2 diabetes (PMID:15919813). The molecular mass of PTPN1 is 50 kDa, but sometimes some truncated forms can be detected as 48, 46, 39, 37 kDa due to non-specific proteolytic cleavage of PTP1B in different cells (PMID: 18253097).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PTPN1/PTP1B antibody CL488-85905-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...