CoraLite® Plus 488-conjugated PTPN1/PTP1B Recombinant monoclonal antibody

• 

  IF Staining of BxPC-3 using CL488-85905-4

  Immunofluorescent analysis of (-20°C Ethanol) fixed BxPC-3 cells using CoraLite® Plus 488 PTPN1/PTP1B antibody (CL488-85905-4, Clone: 250215G6 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

PTPN1/PTP1B Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-85905-4

Clone No.250215G6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

PTP1B, PTPN1, EC:3.1.3.48, Protein-tyrosine phosphatase 1B, PTP 1B

---

Tested Applications

• Positive IF/ICC detected in: BxPC-3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85905-4 targets PTPN1/PTP1B in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1878

  Product name: Recombinant human PTPN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-435 aa of BC015660

  Sequence: MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT

• Full Name: protein tyrosine phosphatase, non-receptor type 1
• Calculated Molecular Weight: 435 aa, 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC015660
• Gene Symbol: PTP1B
• Gene ID (NCBI): 5770
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P18031
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

PTPN1 (protein tyrosine phosphatase, non-receptor type 1) is also named as PTP1B or PTP-1B, and belongs to the protein-tyrosine phosphatase family and non-receptor class 1 subfamily. PTPN1 is involved in the regulation of several important physiological pathways, which regulates both INS and leptin signaling, and interacts with the epidermal-and platelet-derived growth factor receptors (PMID: 20101100). The gene might harbor variants influencing susceptibility to INS resistance and type 2 diabetes (PMID:15919813). The molecular mass of PTPN1 is 50 kDa, but sometimes some truncated forms can be detected as 48, 46, 39, 37 kDa due to non-specific proteolytic cleavage of PTP1B in different cells (PMID: 18253097).