PTPN18 Polyclonal antibody

• 

  WB analysis of Jurkat using 17551-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17551-1-AP (PTPN18 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 17551-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 17551-1-AP (PTPN18 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human brain using 17551-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 17551-1-AP (PTPN18 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human brain using 17551-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 17551-1-AP (PTPN18 antibody) at dilution of 1:100 (under 40x lens).

PTPN18 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17551-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

BDP1, Brain derived phosphatase, PTP HSCF, PTPN18

---

Tested Applications

• Positive WB detected in: Jurkat cells, human brain tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

17551-1-AP targets PTPN18 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11704

  Product name: Recombinant human PTPN18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC052800

  Sequence: MSRSLDSARSFLERLEARGGREGAVLAGEFSKRCERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTFQKESRSVYQLQYMSWPDRGVPSSPDHMLAMVEEARRLQGSGPEPLCVHCSAGCGRTGVLCTVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMFCSTLQNASPHYQNIKENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPGSPGHAMADTYAVVQKRGAPAGAGSGTQTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV

• Full Name: protein tyrosine phosphatase, non-receptor type 18 (brain-derived)
• Calculated Molecular Weight: 460 aa, 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC052800
• Gene Symbol: PTPN18
• Gene ID (NCBI): 26469
• RRID: AB_2284599
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99952
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTPN18(Tyrosine-protein phosphatase non-receptor type 18) is also named as BDP1 and belongs to the protein-tyrosine phosphatase family. The PTPN18 cDNA encodes a deduced 459-amino acid protein with no transmembrane domain and a calculated molecular weight of 50 kD. PTPN18 has a PEST motif and shares the greatest homology with members of the PTP-PEST gene family. Northern blot analysis indicated that PTPN18 is expressed not only in brain, but also in colon and several different tumor-derived cell lines.(PMID:8950995). It has 2 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Cell Physiol Biochem; Prognostic Value of Phosphotyrosine Phosphatases in Hepatocellular Carcinoma.; Authors - Guangyan Zhangyuan
human,mouse	IHC,IF	Mol Cancer Res; Hepatitis B virus X protein represses expression of tumor suppressor PTPN18 in hepatocellular carcinoma; Authors - Zhenyu Zhou
human	WB	Clin Exp Pharmacol Physiol; Downregulation of PTPN18 can inhibit proliferation and metastasis and promote apoptosis of endometrial cancer.; Authors - Junhong Cai