CoraLite® Plus 750-conjugated PTPN18 Recombinant monoclonal antibody

• 

  WB analysis using CL750-83024

  Various lysates were subjected to SDS PAGE followed by western blot with CL750-83024 (PTPN18 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of MCF-7 using CL750-83024

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug CoraLite® Plus 750-conjugated PTPN18 Recombinant antibody (CL750-83024, Clone:230154G8)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

PTPN18 Uni-rAb^® Recombinant Antibody for WB, FC (Intra)

Cat No. CL750-83024

Clone No.230154G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra)

Synonyms

230154G8, BDP1, Brain-derived phosphatase, EC:3.1.3.48, PTP HSCF

---

Tested Applications

• Positive WB detected in: HepG2 cells, MCF-7 cells, T-47D cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL750-83024 targets PTPN18 in WB, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34048

  Product name: Recombinant human PTPN18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 250-351 aa of BC052800

  Sequence: VQKRGAPAGAGSGTQTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV

• Full Name: protein tyrosine phosphatase, non-receptor type 18 (brain-derived)
• Calculated Molecular Weight: 460 aa, 50 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC052800
• Gene Symbol: PTPN18
• Gene ID (NCBI): 26469
• RRID: AB_3673762
• Conjugate: CoraLite® Plus 750 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 755 nm / 780 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99952
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

PTPN18 (also called PTP-HSCF or BDP1), a member of the protein tyrosine phosphatase superfamily, has been reported to be a tumor suppressor in breast cancer by dephosphorylating HER2 and suppressing cell proliferation and invasion. In addition to the well-established role of PTPN18 in breast cancer, our previous study found that PTPN18 and CSK cooperate to inhibit the events triggered by SRC kinases. (PMID: 35982039)