CoraLite® Plus 488-conjugated PTPN9 Monoclonal antibody

• 

  IF Staining of U2OS using CL488-67931

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using CoraLite® Plus 488 PTPN9 antibody (CL488-67931, Clone: 1D6E4 ) at dilution of 1:200.

• 

  IF Staining of U2OS using CL488-67931

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using CoraLite® Plus 488 PTPN9 antibody (CL488-67931, Clone: 1D6E4 ) at dilution of 1:200.

• 

  FC experiment of MCF-7 using CL488-67931

  1X10^6 MCF-7 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human PTPN9 (CL488-67931, Clone:1D6E4) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

PTPN9 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-67931

Clone No.1D6E4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig

Applications

IF/ICC, FC (Intra)

Synonyms

MEG2, PTPaseMEG2, PTPase MEG2, Protein-tyrosine phosphatase MEG2, EC:3.1.3.48

---

Tested Applications

• Positive IF/ICC detected in: U2OS cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67931 targets PTPN9 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30615

  Product name: Recombinant human PTPN9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 248-593 aa of BC010863

  Sequence: FQFLPQVNGHPDPFDEIILFSLPPALDWDSVHVPGPHAMTIQELVDYVNARQKQGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEKDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSSGQNLLAVESQ

• Full Name: protein tyrosine phosphatase, non-receptor type 9
• Calculated Molecular Weight: 593 aa, 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC010863
• Gene Symbol: PTPN9
• Gene ID (NCBI): 5780
• RRID: AB_2923831
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P43378
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

PTPN9, Tyrosine-protein phosphatase non-receptor type 9, is a member of the protein tyrosine phosphatase (PTP) family. PTPs are signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTPN9 is involved in the transfer of hydrophobic ligands or in functions of the Golgi apparatus (PMID: 19167335). MiR-96 inhibits PTPN9 expression and consequently promotes proliferation, migration and invasion of breast cancer cells (PMID:27857177).