Parvalbumin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Parvalbumin Polyclonal antibody, PBS Only (29312-1-PBS)

• 

  WB analysis using 29312-1-AP (same clone as 29312-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 29312-1-AP (Parvalbumin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29312-1-AP (same clone as 29312-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 29312-1-AP (Parvalbumin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29312-1-AP (same clone as 29312-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29312-1-AP (Parvalbumin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 29312-1-AP (same clone as 29312-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 29312-1-AP (Parvalbumin antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 29312-1-AP (same clone as 29312-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 29312-1-AP (Parvalbumin antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat cerebellum using 29312-1-AP (same clone as 29312-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 29312-1-AP (Parvalbumin antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat cerebellum using 29312-1-AP (same clone as 29312-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 29312-1-AP (Parvalbumin antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 29312-1-AP (same clone as 29312-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29312-1-AP (Parvalbumin antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 29312-1-AP (same clone as 29312-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29312-1-AP (Parvalbumin antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 29312-1-AP (same clone as 29312-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse cerebellum tissue using Parvalbumin antibody (29312-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 29312-1-AP (same clone as 29312-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse cerebellum tissue using Parvalbumin antibody (29312-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 29312-1-AP (same clone as 29312-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using Parvalbumin antibody (29312-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 29312-1-AP (same clone as 29312-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using Parvalbumin antibody (29312-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 29312-1-AP (same clone as 29312-1-PBS)

  Immunofluorescent analysis of (-20°C Acetone) fixed paraffin-embedded mouse cerebellum tissue using Parvalbumin antibody (29312-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 29312-1-AP (same clone as 29312-1-PBS)

  Immunofluorescent analysis of (-20°C Acetone) fixed paraffin-embedded mouse cerebellum tissue using Parvalbumin antibody (29312-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat cerebellum using 29312-1-AP (same clone as 29312-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat cerebellum tissue using Parvalbumin antibody (29312-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat cerebellum using 29312-1-AP (same clone as 29312-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat cerebellum tissue using Parvalbumin antibody (29312-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum tissue using 29312-1-AP (same clone as 29312-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed adult mouse cerebellum tissue using Parvalbumin antibody (29312-1-AP) at dilution of 1:1500 and Alexa Fluor 594 AffiniPure Donkey Anti-Rabbit IgG (H+L). (Image produced by Watt Lab at McGill University) This data was developed using the same antibody clone with 29312-1-PBS in a different storage buffer formulation.

Parvalbumin Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 29312-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

PVALB, Parvalbumin alpha

---

Product Information

29312-1-PBS targets Parvalbumin in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30189

  Product name: Recombinant human PVALB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-110 aa of NM_002854

  Sequence: SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES

• Full Name: parvalbumin
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: NM_002854
• Gene Symbol: Parvalbumin
• Gene ID (NCBI): 5816
• RRID: AB_2918280
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20472
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PVALB is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. PVALB is expressed in high levels only in fast-contracting muscles and at lower levels in brain and several endocrine tissues. It is thought to be involved in muscle relaxation. Monomeric (12 kDa) and dimeric (24 kDa) forms, as well as trimeric Parvalbumin (38 kDa), have been described in a literature (PMID: 19616851).