Proenkephalin-A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Proenkephalin-A Polyclonal antibody, PBS Only (32272-1-PBS)

• 

  WB analysis using 32272-1-AP (same clone as 32272-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32272-1-AP (PENK antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32272-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 32272-1-AP (same clone as 32272-1-PBS)

  Fetal human brain was subjected to SDS PAGE followed by western blot with 32272-1-AP (Proenkephalin-A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32272-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 32272-1-AP (same clone as 32272-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32272-1-AP (Proenkephalin-A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32272-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 32272-1-AP (same clone as 32272-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 32272-1-AP (Proenkephalin-A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32272-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 32272-1-AP (same clone as 32272-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 32272-1-AP (Proenkephalin-A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32272-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 32272-1-AP (same clone as 32272-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 32272-1-AP (Proenkephalin-A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32272-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 32272-1-AP (same clone as 32272-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 32272-1-AP (Proenkephalin-A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32272-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 32272-1-AP (same clone as 32272-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using Proenkephalin-A antibody (32272-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 32272-1-PBS in a different storage buffer formulation.

Proenkephalin-A Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 32272-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

PENK, Proenkephalin A, Opioid growth factor, Met-enkephalin-Arg-Phe, Met-enkephalin-Arg-Gly-Leu

---

Product Information

32272-1-PBS targets Proenkephalin-A in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27972

  Product name: Recombinant human PENK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-267 aa of BC032505

  Sequence: YGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF

• Full Name: proenkephalin
• Calculated Molecular Weight: 267 aa, 31 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC032505
• Gene Symbol: Proenkephalin A
• Gene ID (NCBI): 5179
• RRID: AB_3742560
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P01210
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Proenkephalin-A (PENK) is also named as Synenkephalin, Met-enkephalin and Opioid growth factor (OGF), and belongs to the opioid neuropeptide precursor family. PENK is a neuropeptide that competes with and mimics the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress (PMID:7057924). PENK hypermethylation is also associated with bladder cancer, hepatocellular carcinoma, colorectal cancer, and prostate cancer (PMID:36403035). Proenkephalin (PENK) represents a new candidate to determine kidney function. This peptide is cleaved from the precursor peptide preproenkephalin A alongside enkephalins (endogenous opioids) and is filtrated in the glomerulus (PMID: 33636859).