Home
Products
Primary Antibodies
QRICH1 Polyclonal antibody, PBS Only (30236-1-PBS)

Filter: AllWBIHCIF/ICC

WB analysis using 30236-1-AP (same clone as 30236-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 30236-1-AP (QRICH1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30236-1-PBS in a different storage buffer formulation.
WB analysis of Jurkat using 30236-1-AP (same clone as 30236-1-PBS)
WB result of QRICH1 antibody (30236-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-QRICH1 transfected Jurkat cells. This data was developed using the same antibody clone with 30236-1-PBS in a different storage buffer formulation.
WB analysis using 30236-1-AP (same clone as 30236-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 30236-1-AP (QRICH1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30236-1-PBS in a different storage buffer formulation.
IHC staining of mouse testis using 30236-1-AP (same clone as 30236-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30236-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 30236-1-AP (same clone as 30236-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30236-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 30236-1-AP (same clone as 30236-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30236-1-PBS in a different storage buffer formulation.
IHC staining of mouse testis using 30236-1-AP (same clone as 30236-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30236-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 30236-1-AP (same clone as 30236-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30236-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 30236-1-AP (same clone as 30236-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30236-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 30236-1-AP (same clone as 30236-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30236-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 30236-1-AP (same clone as 30236-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30236-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 30236-1-AP (same clone as 30236-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30236-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 30236-1-AP (same clone as 30236-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30236-1-PBS in a different storage buffer formulation.
IHC staining of mouse stomach using 30236-1-AP (same clone as 30236-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30236-1-PBS in a different storage buffer formulation.
IF Staining of U2OS using 30236-1-AP (same clone as 30236-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed U2OS cells using QRICH1 antibody (30236-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 30236-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

QRICH1 Polyclonal antibody, PBS Only

Name: QRICH1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 30236-1-PBS

QRICH1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30236-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Transcriptional regulator QRICH1, Glutamine-rich protein 1, Glutamine rich protein 1, glutamine rich 1

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

30236-1-PBS targets QRICH1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag31997 Product name: Recombinant human QRICH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC110855 Sequence: MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEFQQTATTTMVYQQGGNCIYTDSTEVAGSLLELACPVTTSVQPQTQQEQQIQVQQPQQVQVQVQVQQSPQQVSAQLSPQLTVHQPTEQPIQVQVQIQGQAPQSAAPSIQTPSLQSPSPSQLQAAQIQVQHVQAAQQIQAAEIPEEHIPHQQIQAQLVAGQSLAGGQQIQIQTVGALSPPPSQQGSPREGERRVGTASVLQPVKKRKVDMPITVSYAISGQPVATVLAIPQGQQQSYVSLRPDLLTVDSAHLYSATGT Predict reactive species
Full Name	glutamine-rich 1
Observed Molecular Weight	85-110 kDa
GenBank Accession Number	BC110855
Gene Symbol	QRICH1
Gene ID (NCBI)	54870
RRID	AB_3086273
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q2TAL8
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Glutamine-rich protein 1 (QRICH1) is a transcriptional regulator that acts as a mediator of the integrated stress response (ISR) through transcriptional control of protein homeostasis under conditions of ER stress (PMID:33384352). QRICH1 is a member of the caspase recruitment domain (CARD)-containing gene family, which encodes for proteins implicated in regulation of caspase activation in the context of apoptosis and inflammation, and in regulation of NF-κB signaling(PMID:33384352). QRICH1 can be modified by phosphorylation.