CoraLite® Plus 488-conjugated RAB1B Recombinant monoclonal antibody

RAB1B Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83687-4
Clone No.240635D9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

240635D9, EC:3.6.5.2, Ras related protein Rab 1B, Ras-related protein Rab-1B

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83687-4 targets RAB1B in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag12197

Product name: Recombinant human RAB1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-201 aa of BC071169

Sequence: MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC

Predict reactive species
Full Name RAB1B, member RAS oncogene family
Calculated Molecular Weight 201 aa, 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC071169
Gene Symbol RAB1B
Gene ID (NCBI) 81876
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H0U4
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Ras-related protein Rab-1B (RAB1B) belongs to the small GTPase superfamily and Rab family. Rab1b, a GTPase regulating secretory transport, was recently associated with targeting proteins to LDs in a Drosophila RNAi screen. Rab1b recruits lipid-synthesizing enzymes, facilitating Lipid droplets (LDs) growth. The small GTPase Rab1b interacts with diacylglycerol acyltransferase 2 to facilitate its targeting to the surface of lipid droplets. (PMID: 38809969). Rab1b, an extensively studied and established master regulator of ER-to-Golgi transport. The mechanism of Rab1b's function is to promote ER to LD surface targeting of those triglyceride-synthesizing enzymes that can associate with the unique lipid monolayer comprising the LD surface (PMID: 38809969). Rab1b is a regulatory protein involved in both COPI and COPII transport (PMID: 17429068).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RAB1B antibody CL488-83687-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...