Tested Applications
| Positive WB detected in | HeLa cells, K562, K-562 cells, Jurkat cells, HEK-293 cells, HL-60 cells, HepG2 cells |
| Positive IHC detected in | human lymphoma tissue, human colon cancer tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:5000-1:20000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66058-1-Ig targets RAB27A in WB, IHC, IF, FC (Intra), ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12382 Product name: Recombinant human RAB27A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-221 aa of BC107680 Sequence: MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC Predict reactive species |
| Full Name | RAB27A, member RAS oncogene family |
| Calculated Molecular Weight | 221 aa, 25 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC107680 |
| Gene Symbol | RAB27A |
| Gene ID (NCBI) | 5873 |
| RRID | AB_11042596 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P51159 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Rab27A is a member of a large family of Ras-related small GTPases. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Recent studies suggest that Rab27A is associated with melanosomes in pigmented cells and regulates melanosome transport via its interaction with actin-based cellular motors such as myosin Va and myosin VIIa. RAB27A is also required for regulated secretion in cytotoxic T lymphocytes. Rab27A is implicated in several diseases, including Griscelli syndrome, choroideremia, and the Hermansky-Pudlak syndrome mouse model, gunmetal.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for RAB27A antibody 66058-1-Ig | Download protocol |
| IHC protocol for RAB27A antibody 66058-1-Ig | Download protocol |
| WB protocol for RAB27A antibody 66058-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RAB27A Monoclonal antibody (1C4B8), catalog number 66058-1-Ig, has 8 total citations. These appear in journals including Cell Metabolism, Nature Cell Biology, Science Advances, Cell Reports, Journal of Advanced Research, Stem Cell Research & Therapy, and Molecular Genetics and Genomics. Associated research fields span oncology (pancreatic and brain tumors), immunology (T cells, dendritic cells, neutrophils), cardiac injury, renal inflammation, epigenetics, and extracellular vesicle biology.
| Species | Application | Title |
|---|---|---|
Cell Metab Arachidonic acid triggers spermidine synthase secretion from primary tumor to induce skeletal muscle weakness upon irradiation | ||
Nat Cell Biol Psychological stress-induced ALKBH5 deficiency promotes tumour innervation and pancreatic cancer via extracellular vesicle transfer of RNA | ||
J Adv Res Podocyte-derived exosomes instruct dendritic cell-dependent CD8(+) T cell activation and proliferation in renal inflammation. | ||
Sci Adv Immune cell infiltration into brain tumor microenvironment is mediated by Rab27-regulated vascular wall integrity | ||
Stem Cell Res Ther Empagliflozin-pretreated BMSC exosomes attenuate myocardial ischemia-reperfusion injury by enhancing atad3a/pink1-dependent mitophagy. | ||
Cell Rep Unveiling the molecular architecture of T cells and immune synapses with cryo-expansion microscopy. |



















