CoraLite® Plus 647-conjugated RAB27A Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 647-conjugated RAB27A Monoclonal antibody (CL647-66058)

• 

  FC experiment of HeLa using CL647-66058

  1x10^6 HeLa cells were intracellularly stained with 0.4 ug Coralite® Plus 647 Rab27a Monoclonal Antibody (CL647-66058, Clone:1C4B8)(red), or 0.4 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• Featured Product
• KD/KO Validated

RAB27A Monoclonal Antibody for FC (Intra)

Cat No. CL647-66058

Clone No.1C4B8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

FC (Intra)

Synonyms

1C4B8, EC:3.6.5.2, GTP binding protein Ram, GTP-binding protein Ram, Rab 27

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-66058 targets RAB27A in FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12382

  Product name: Recombinant human RAB27A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-221 aa of BC107680

  Sequence: MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC

• Full Name: RAB27A, member RAS oncogene family
• Calculated Molecular Weight: 221 aa, 25 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC107680
• Gene Symbol: RAB27A
• Gene ID (NCBI): 5873
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P51159
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Rab27A is a member of a large family of Ras-related small GTPases. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Recent studies suggest that Rab27A is associated with melanosomes in pigmented cells and regulates melanosome transport via its interaction with actin-based cellular motors such as myosin Va and myosin VIIa. RAB27A is also required for regulated secretion in cytotoxic T lymphocytes. Rab27A is implicated in several diseases, including Griscelli syndrome, choroideremia, and the Hermansky-Pudlak syndrome mouse model, gunmetal.