RAD17 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RAD17 Polyclonal antibody, PBS Only (13358-1-PBS)

• 

  WB analysis using 13358-1-AP (same clone as 13358-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13358-1-AP (RAD17 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13358-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 13358-1-AP (same clone as 13358-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 13358-1-AP (RAD17 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13358-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 13358-1-AP (same clone as 13358-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 13358-1-AP (RAD17 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 13358-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13358-1-AP (same clone as 13358-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 13358-1-AP (RAD17 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13358-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13358-1-AP (same clone as 13358-1-PBS)

  Immunofluorescent analysis of Hela cells, using RAD17 antibody 13358-1-AP at 1:50 dilution and FITC-labeled donkey anti-rabbit IgG (green). Blue pseudocolor = DAPI (fluorescent DNA dye). This data was developed using the same antibody clone with 13358-1-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 13358-1-AP (same clone as 13358-1-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.25 ug RAD17 Polyclonal antibody (13358-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 13358-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RAD17 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 13358-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

RF-C/activator 1 homolog, R24L, HRAD17

---

Product Information

13358-1-PBS targets RAD17 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4171

  Product name: Recombinant human RAD17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 421-670 aa of BC032304

  Sequence: LVEPEEVVEMSHMPGDLFNLYLHQNYIDFFMEIDDIVRASEFLSFADILSGDWNTRSLLREYSTSIATRGVMHSNKARGYAHCQGGGSSFRPLHKPQWFLINKKYRENCLAAKALFPDFCLPALCRQTQLLPYLALLTIPMRNQAQISFIQDIGRLPLKRHFGRLKMEALTDREHGMIDPDSGDEAQLNGGHSAEESLGEPTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT

• Full Name: RAD17 homolog (S. pombe)
• Calculated Molecular Weight: 681 aa, 71 kDa
• Observed Molecular Weight: 71 kDa
• GenBank Accession Number: BC032304
• Gene Symbol: RAD17
• Gene ID (NCBI): 5884
• RRID: AB_2269268
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75943
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.