• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated RAD21 Polyclonal antibody

RAD21 Polyclonal Antibody for IF/ICC
Cat No. CL488-27071

Host / Isotype

Rabbit / IgG

Reactivity

human, canine

Applications

IF/ICC

HR21, hHR21, FLJ40596, FLJ25655, Double-strand-break repair protein rad21 homolog

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMDCK cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-27071 targets RAD21 in IF/ICC applications and shows reactivity with human, canine samples.

Tested Reactivity human, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25481

Product name: Recombinant human RAD21 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 147-349 aa of BC050381

Sequence: EEVGNISILQENDFGDFGMDDREIMREGSAFEDDDMLVSTTTSNLLLESEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGGIFDDPPALSEAGVMLPEQPAHDDMDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVT

Predict reactive species
Full Name RAD21 homolog (S. pombe)
Calculated Molecular Weight 631 aa, 72 kDa
Observed Molecular Weight 120 kDa
GenBank Accession NumberBC050381
Gene Symbol RAD21
Gene ID (NCBI) 5885
RRIDAB_3084105
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60216
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RAD21, also named as Nuclear matrix protein 1, is a 631 amino acid protein, which belongs to the rad21 family. The calculated molecular weight of RAD21 is 72 kDa, but the phosphorylated RAD21 is about 120 kDa. The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad21, a gene involved in the repair of DNA double-strand breaks, as well as in chromatid cohesion during mitosis. This protein is a nuclear phospho-protein, which becomes hyperphosphorylated in cell cycle M phase. The highly regulated association of this protein with mitotic chromatin specifically at the centromere region suggests its role in sister chromatid cohesion in mitotic cells

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RAD21 antibody CL488-27071Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...