RAE1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RAE1 Polyclonal antibody, PBS Only (20491-1-PBS)

• 

  WB analysis of BxPC-3 using 20491-1-AP (same clone as 20491-1-PBS)

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 20491-1-AP (RAE1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20491-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 20491-1-AP (same clone as 20491-1-PBS)

  WB result of RAE1 antibody (20491-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-RAE1 transfected MCF-7 cells. This data was developed using the same antibody clone with 20491-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 20491-1-AP (same clone as 20491-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20491-1-AP (RAE1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20491-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 20491-1-AP (same clone as 20491-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 20491-1-AP (RAE1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20491-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 20491-1-AP (same clone as 20491-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 20491-1-AP (RAE1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 20491-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 20491-1-AP (same clone as 20491-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 20491-1-AP (RAE1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 20491-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 20491-1-AP (same clone as 20491-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using RAE1 antibody (20491-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 20491-1-PBS in a different storage buffer formulation.

RAE1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 20491-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

MIG14, Mnrp41, mRNA export factor, mRNA export factor RAE1, mRNA-associated protein mrnp 41

---

Product Information

20491-1-PBS targets RAE1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12102

  Product name: Recombinant human RAE1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-368 aa of BC103754

  Sequence: MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK

• Full Name: RAE1 RNA export 1 homolog (S. pombe)
• Calculated Molecular Weight: 368 aa, 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC103754
• Gene Symbol: RAE1
• Gene ID (NCBI): 8480
• RRID: AB_2878693
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P78406
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAE1 acts as a mRNA export factor involved in nucleocytoplasmic transport, it plays a role in mitotic bipolar spindle formation. (PMID: 33849972, MID: 17172455)