MOK Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MOK Polyclonal antibody (23926-1-AP)

• Featured Product
• KD/KO Validated

MOK Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 23926-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

RAGE, EC:2.7.11.22, MOK protein kinase, RAGE 1, RAGE1

• 

  WB analysis of HeLa using 23926-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 23926-1-AP (MOK antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 23926-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 23926-1-AP (MOK antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 23926-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 23926-1-AP (MOK antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hepatocirrhosis using 23926-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 23926-1-AP (MOK antibody at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hepatocirrhosis using 23926-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 23926-1-AP (MOK antibody at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 23926-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 23926-1-AP (MOK antibody at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 23926-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 23926-1-AP (MOK antibody at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 23926-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 23926-1-AP (MOK antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 23926-1-AP

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug MOK Polyclonal antibody (23926-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MOK in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive IHC detected in: human hepatocirrhosis tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23926-1-AP targets MOK in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20849

  Product name: Recombinant human RAGE protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-231 aa of BC053536

  Sequence: MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIHRNGIFHRDVKPENILIKQDVLKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYTYKMDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPAQKILTKFKQ

• Full Name: renal tumor antigen
• Calculated Molecular Weight: 231 aa, 27 kDa
• Observed Molecular Weight: 42 kDa, 85 kDa
• GenBank Accession Number: BC053536
• Gene Symbol: RAGE
• Gene ID (NCBI): 5891
• RRID: AB_2879364
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UQ07
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MOK polyclonal antibody (Cat# 23926-1-AP) has 2 citations. One appears in Journal of Biological Chemistry (2017), studying ULK1-mediated phosphorylation of Cdc37 and its effect on client protein stability, falling under cell signaling and protein modification research. The other is in Frontiers in Oncology (2022), examining proteomic and phosphoproteomic alterations in chordoma biopsies, associated with cancer biology and kinome profiling. Both citations used the antibody for Western blot applications.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	J Biol Chem; Serine/Threonine Kinase Unc-51-like Kinase-1 (Ulk1) Phosphorylates the Co-chaperone Cell Division Cycle Protein 37 (Cdc37) and Thereby Disrupts the Stability of Cdc37 Client Proteins.; Authors - Ran Li
human	WB	Front Oncol; Proteomics and phosphoproteomics of chordoma biopsies reveal alterations in multiple pathways and aberrant kinases activities; Authors - Jing Hang ; KD Validated