RALB Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 67094-1-Ig (same clone as 67094-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67094-1-Ig (RALB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67094-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67094-1-Ig (same clone as 67094-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67094-1-Ig (RALB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67094-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 67094-1-Ig (same clone as 67094-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67094-1-Ig (RALB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67094-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 67094-1-Ig (same clone as 67094-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67094-1-Ig (RALB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67094-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse bladder using 67094-1-Ig (same clone as 67094-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse bladder tissue slide using 67094-1-Ig (RALB antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67094-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse placenta using 67094-1-Ig (same clone as 67094-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 67094-1-Ig (RALB antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67094-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 67094-1-Ig (same clone as 67094-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67094-1-Ig (RALB antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67094-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 67094-1-Ig (same clone as 67094-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 67094-1-Ig (RALB antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67094-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67094-1-Ig (same clone as 67094-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67094-1-Ig (RALB antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67094-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human lung cancer using 67094-1-Ig (same clone as 67094-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human lung cancer tissue using RALB antibody (67094-1-Ig, Clone: 1D11C11 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67094-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50129-1

  Cytometric bead array standard curve of MP50129-1, RALB Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67094-2-PBS. Detection antibody: 67094-1-PBS. Standard:Ag28600. Range: 6.25-100 ng/mL.

RALB Monoclonal Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 67094-1-PBS

Clone No.1D11C11

Host / Isotype

Mouse / IgG2a

Reactivity

Human, rat, pig, mouse

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

Synonyms

RALB, Ras related protein Ral B

---

Product Information

67094-1-PBS targets RALB as part of a matched antibody pair:

MP50129-1: 67094-2-PBS capture and 67094-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: Human, rat, pig, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Affinity:
  K_D=1.82 x 10^-10M
  K_Off=2.54 x 10^-6M
  K_On=1.40 x 10^4M
• Immunogen:

  CatNo: Ag28600

  Product name: Recombinant human RALB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-206 aa of BC018163

  Sequence: MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL

• Full Name: v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein)
• Calculated Molecular Weight: 206 aa, 23 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC018163
• Gene Symbol: RALB
• Gene ID (NCBI): 5899
• RRID: AB_2882399
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P11234
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.