RALB Monoclonal antibody, PBS Only (Detector)

RALB Monoclonal Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 67094-1-PBS
Clone No.1D11C11

Host / Isotype

Mouse / IgG2a

Reactivity

Human, rat, pig, mouse

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

RALB, Ras related protein Ral B

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67094-1-PBS targets RALB as part of a matched antibody pair:

MP50129-1: 67094-2-PBS capture and 67094-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity Human, rat, pig, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Affinity
KD=1.82 x 10-10M
KOff=2.54 x 10-6M
KOn=1.40 x 104M
Immunogen

CatNo: Ag28600

Product name: Recombinant human RALB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-206 aa of BC018163

Sequence: MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL

Predict reactive species
Full Name v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein)
Calculated Molecular Weight 206 aa, 23 kDa
Observed Molecular Weight 24 kDa
GenBank Accession NumberBC018163
Gene Symbol RALB
Gene ID (NCBI) 5899
RRIDAB_2882399
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11234
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...