RALYL Monoclonal antibody

• Home
• Products
• Primary Antibodies
• RALYL Monoclonal antibody (67534-1-Ig)

RALYL Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67534-1-Ig Copied!

Clone No. 1F3F4

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA
For FC, select conjugated version.

Synonyms

1F3F4, Heterogeneous nuclear ribonucleoprotein C-like 3, hnRNP core protein C like 3, hnRNP core protein C-like 3, HNRPCL3

• 

  WB analysis using 67534-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67534-1-Ig (RALYL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67534-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67534-1-Ig (RALYL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67534-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67534-1-Ig (RALYL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67534-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67534-1-Ig (RALYL antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig brain using 67534-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67534-1-Ig (RALYL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 67534-1-Ig

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67534-1-Ig (RALYL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 67534-1-Ig

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67534-1-Ig (RALYL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 67534-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 67534-1-Ig (RALYL antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 67534-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using RALYL antibody (67534-1-Ig, Clone: 1F3F4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RALYL in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: pig brain tissue, HEK-293 cells, HeLa cells, mouse brain tissue, rat brain tissue, LNCaP cells, IMR-32 cells, Daudi cells, NK-92 cells, HepG2 cells, Raji cells, rabbit brain tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67534-1-Ig targets RALYL in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11676

  Product name: Recombinant human RALYL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-291 aa of BC031090

  Sequence: MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARAAVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLSVGGYVFDYDYYRDDFYNRLFDYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSDELQTIKKELTQIKTKIDSLLGRLEKIEKQQKAEAEAQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK

• Full Name: RALY RNA binding protein-like
• Calculated Molecular Weight: 291 aa, 32 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC031090
• Gene Symbol: RALYL
• Gene ID (NCBI): 138046
• RRID: AB_2882753
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q86SE5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RALYL Monoclonal antibody (1F3F4), catalog number 67534-1-Ig, has a total of 1 citation. It appears in Cancer Reports (Hoboken), published in 2025. The cited study investigates how RALYL overexpression suppresses colorectal cancer by modulating HNRNPC-mediated MNK2 alternative splicing, placing it in the research fields of cancer biology, gene splicing regulation, and oncology. The antibody was validated for WB and IHC applications in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Cancer Rep (Hoboken); RALYL Overexpression Suppresses Colorectal Cancer via Modulating HNRNPC-Mediated MNK2 Alternative Splicing; Authors - Zenghui Ma