CoraLite® Plus 488-conjugated RALYL Monoclonal antibody

RALYL Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67534
Clone No.1F3F4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF/ICC, FC (Intra)

hRALYL, HNRPCL3, hnRNP core protein C-like 3, hnRNP core protein C like 3, Heterogeneous nuclear ribonucleoprotein C-like 3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67534 targets RALYL in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11676

Product name: Recombinant human RALYL protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-291 aa of BC031090

Sequence: MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARAAVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLSVGGYVFDYDYYRDDFYNRLFDYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSDELQTIKKELTQIKTKIDSLLGRLEKIEKQQKAEAEAQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK

Predict reactive species
Full Name RALY RNA binding protein-like
Calculated Molecular Weight 291 aa, 32 kDa
Observed Molecular Weight 35-40 kDa
GenBank Accession NumberBC031090
Gene Symbol RALYL
Gene ID (NCBI) 138046
RRIDAB_2919494
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ86SE5
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RALY RNA binding protein-like (RALYL) belongs to the RALY subfamily. RALYL locates in 8q21.2, the function of which is RNA-binding and nucleotide binding. The RALYL high expression in the normal adrenal, kidney and brain (Shyamsundar et al., 2005). Furthermore, RALYL expression down-regulated correlates with mental disorder (Lee et al., 2007), Parkinson's disease (Moran et al., 2006), brain cancer (Maris et al., 2008), adrenal cancer (Giordano et al., 2009) and kidney cancer (Higgins et al., 2003). The expression of RALYL was significantly low in Clear Cell Renal Cell Carcinoma and correlated with a poor prognosis in a large number of clinical samples. Our findings showed that RALYL may be a potential therapeutic target as well as a poor prognostic

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 RALYL antibody CL488-67534Download protocol
IF protocol for CL Plus 488 RALYL antibody CL488-67534Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...