RALYL Monoclonal antibody, PBS Only

• 

  WB analysis using 67534-1-Ig (same clone as 67534-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67534-1-Ig (RALYL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67534-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67534-1-Ig (same clone as 67534-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67534-1-Ig (RALYL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67534-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67534-1-Ig (same clone as 67534-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67534-1-Ig (RALYL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67534-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67534-1-Ig (same clone as 67534-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67534-1-Ig (RALYL antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67534-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67534-1-Ig (same clone as 67534-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67534-1-Ig (RALYL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67534-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 67534-1-Ig (same clone as 67534-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67534-1-Ig (RALYL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67534-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 67534-1-Ig (same clone as 67534-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67534-1-Ig (RALYL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67534-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67534-1-Ig (same clone as 67534-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 67534-1-Ig (RALYL antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67534-1-PBS in a different storage buffer formulation.

RALYL Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67534-1-PBS

Clone No.1F3F4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, ELISA

Synonyms

1F3F4, Heterogeneous nuclear ribonucleoprotein C-like 3, hnRNP core protein C like 3, hnRNP core protein C-like 3, HNRPCL3

---

Product Information

67534-1-PBS targets RALYL in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11676

  Product name: Recombinant human RALYL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-291 aa of BC031090

  Sequence: MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARAAVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLSVGGYVFDYDYYRDDFYNRLFDYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSDELQTIKKELTQIKTKIDSLLGRLEKIEKQQKAEAEAQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK

• Full Name: RALY RNA binding protein-like
• Calculated Molecular Weight: 291 aa, 32 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC031090
• Gene Symbol: RALYL
• Gene ID (NCBI): 138046
• RRID: AB_2882753
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86SE5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.