RAP2C Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RAP2C Polyclonal antibody, PBS Only (33845-1-PBS)

• 

  WB analysis using 33845-1-AP (same clone as 33845-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33845-1-AP (RAP2C antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33845-1-PBS in a different storage buffer formulation.

RAP2C Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33845-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Ras-related protein Rap-2c

---

Product Information

33845-1-PBS targets RAP2C in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38723

  Product name: Recombinant human RAP2C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-183 aa of BC003403

  Sequence: MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALVQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ

• Full Name: RAP2C, member of RAS oncogene family
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC003403
• Gene Symbol: RAP2C
• Gene ID (NCBI): 57826
• RRID: AB_3743092
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y3L5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAP2C is a member of the Ras superfamily, which is the promoter of tumorigenesis. RAP2C plays a key role in the migration and invasion of various tumors, such as osteosarcoma, glioma, and small cell lung cancer (SCLC).(PMID: 29552178; PMID: 32341653; PMID: 33302819)