RAPGEF2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RAPGEF2 Recombinant monoclonal antibody (84331-4-RR)

RAPGEF2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 84331-4-RR Copied!

Clone No. 241637G5

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

241637G5, CNrasGEF, KIAA0313, nRap GEP, NRAPGEP

• 

  WB analysis using 84331-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84331-4-RR (RAPGEF2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of NIH/3T3 using 84331-4-RR

  IP result of anti-RAPGEF2 (IP:84331-4-RR, 4ug; Detection:84331-4-RR 1:1500) with NIH/3T3 cells lysate 1160 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 84331-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 84331-4-RR (RAPGEF2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of Jurkat using 84331-4-RR

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using RAPGEF2 antibody (84331-4-RR, Clone: 241637G5 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 84331-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84331-4-RR against Human RAPGEF2 were performed. The affinity constant is 0.19 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RAPGEF2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, SH-SY5Y cells, Jurkat cells
• Positive IP detected in: NIH/3T3 cells
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84331-4-RR targets RAPGEF2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35288

  Product name: Recombinant human RAPGEF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1255-1400 aa of NM_014247.2

  Sequence: GSHDNIQTIQHQRSWETLPFGHTHFDYSGDPAGLWASSSHMDQIMFSDHSTKYNRQNQSRESLEQAQSRASWASSTGYWGEDSEGDTGTIKRRGGKDVSIEAESSSLTSVTTEETKPVPMPAHIAVASSTTKGLIARKEGRYREPP

• Full Name: Rap guanine nucleotide exchange factor (GEF) 2
• Calculated Molecular Weight: 167kDa
• Observed Molecular Weight: 200 kDa
• GenBank Accession Number: NM_014247.2
• Gene Symbol: RAPGEF2
• Gene ID (NCBI): 9693
• RRID: AB_3671872
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y4G8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RAPGEF2 Recombinant monoclonal antibody (clone 241637G5), catalog number 84331-4-RR, has 1 total citation. It appears in the journal Genet Med (Genetics in Medicine), a publication focused on human genetics and clinical genomics. The cited study used the antibody for Western blot (WB) in human samples, investigating rare heterozygous de novo variants in RAPGEF2 associated with a neurodevelopmental disorder. Thus, the associated research field is human genetics/neurodevelopmental disorder research.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Genet Med; Rare heterozygous de novo variants in RAPGEF2 are associated with a neurodevelopmental disorder.; Authors - Ali H. Bereshneh