• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated RARS Monoclonal antibody

RARS Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-66815
Clone No.1C8G4

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IF/ICC, FC (Intra)

1C8G4, Arginine--tRNA ligase, cytoplasmic, arginyl tRNA synthetase, Arginyl-tRNA synthetase, ArgRS

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHEK-293T cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66815 targets RARS in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26399

Product name: Recombinant human RARS protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-190 aa of BC000528

Sequence: MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGE

Predict reactive species
Full Name arginyl-tRNA synthetase
Calculated Molecular Weight 75 kDa
Observed Molecular Weight 67 kDa
GenBank Accession NumberBC000528
Gene Symbol RARS
Gene ID (NCBI) 5917
RRIDAB_3084275
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP54136
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RARS, also named ArgRS (arginyl-tRNA synthetase), belongs to the class-I aminoacyl-tRNA synthetase family which catalyze the aminoacylation of tRNA by their cognate amino acid. In higher eukaryotes, one of the two arginyl-tRNA synthetases (ArgRSs) has evolved to have an extended N-terminal domain that plays a crucial role in protein synthesis and cell growth and in integration into the multisynthetase complex (MSC) (PMID:25288775). RARS has two isoforms with the molecular weight of 75 and 67 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 RARS antibody CL488-66815Download protocol
IF protocol for CL Plus 488 RARS antibody CL488-66815Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...