CoraLite® Plus 488-conjugated RASGRP2 Polyclonal antibody

RASGRP2 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-30189

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Calcium and DAG-regulated guanine nucleotide exchange factor I, CalDAG-GEFI, CDC25L, Cdc25-like protein, F25B3.3 kinase-like protein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inJurkat cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-30189 targets RASGRP2 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32762

Product name: Recombinant human RASGRP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 370-609 aa of NM_153819

Sequence: QYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGSAPSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTVEDGVFDIHL

Predict reactive species
Full Name RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Calculated Molecular Weight69kd
Observed Molecular Weight69 kDa
GenBank Accession NumberNM_153819
Gene Symbol RASGRP2
Gene ID (NCBI) 10235
RRIDAB_3672845
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ7LDG7
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RASGRP2, also named as CDC25L and MCG7, belongs to the RASGRP family. It functions as a calcium- and DAG-regulated nucleotide exchange factor specifically activating Rap through the exchange of bound GDP for GTP. RASGRP2 may also activate other GTPases such as RRAS, RRAS2, NRAS, KRAS but not HRAS. RASGRO2 functions in aggregation of platelets and adhesion of T-lymphocytes and neutrophils probably through inside-out integrin activation. It may function in the muscarinic acetylcholine receptor M1/CHRM1 signaling pathway. The antibody recognizes the C-term of RASGRP2.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 RASGRP2 antibody CL488-30189Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...