CoraLite®594-conjugated RASGRP3 Monoclonal antibody

RASGRP3 Monoclonal Antibody for IF/ICC

Cat No. CL594-66650
Clone No.1A10G4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse

Applications

IF/ICC

GRP3, KIAA0846, Ras guanyl releasing protein 3, RASGRP3

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66650 targets RASGRP3 in IF/ICC applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3810

Product name: Recombinant human RASGRP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 342-690 aa of BC027849

Sequence: SLQNASHHLEPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKHIRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG

Predict reactive species
Full Name RAS guanyl releasing protein 3 (calcium and DAG-regulated)
Calculated Molecular Weight 690 aa, 78 kDa
Observed Molecular Weight 78 kDa
GenBank Accession NumberBC027849
Gene Symbol RASGRP3
Gene ID (NCBI) 25780
RRIDAB_2934738
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8IV61
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

AS guanyl releasing protein 3 (RasGRP3) is a member of the RasGRP family and is able to promote guanine nucleotide exchange of Ha-Ras, R-Ras and Rap1 (PMID: 9582122). RasGRP3 is involved in a diverse range of important biological processes. RasGRP3 has emerged as an important mediator of signaling downstream from receptor coupled phosphoinositide turnover in B and T cells. Overexpression of RasGRP3 is commonly associated with many malignancies, such as pre-Bcell leukemia, Burkitt's lymphoma and natural killer-like T-cell leukemia. Recently, it has been reported that upregulation of RASGRP3 expression in prostate cancer correlates with aggressive capabilities and predicts biochemical recurrence after radical prostatectomy (PMID: 24418912).

Protocols

Product Specific Protocols
IF protocol for CL594 RASGRP3 antibody CL594-66650Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...