• Featured Product
  • KD/KO Validated

RBAP48 Monoclonal antibody, PBS Only

RBAP48 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 66060-1-PBS
Clone No.5C4D6

Host / Isotype

Mouse / IgG2b

Reactivity

rat, mouse, human

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

RBBP4, Nucleosome-remodeling factor subunit RBAP48, Histone-binding protein RBBP4, CAF-I p48, CAF-I 48 kDa subunit

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66060-1-PBS targets RBAP48 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with rat, mouse, human samples.

Tested Reactivity rat, mouse, human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6196

Product name: Recombinant human RBBP4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-425 aa of BC053904

Sequence: MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS

Predict reactive species
Full Name retinoblastoma binding protein 4
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC053904
Gene Symbol RBBP4
Gene ID (NCBI) 5928
RRIDAB_11064731
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ09028
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Histone-binding protein RBBP4 (also known as RbAp48, or NURF55) is a protein that in humans is encoded by the RBBP4 gene. This gene encodes a ubiquitously expressed nuclear protein that belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2/NuRD complex complex that has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of corepressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. A decrease of RbAp48 in the dentate gyrus (DG) of the hippocampus in the brain is suspected to be a main cause of memory loss in normal aging (PMID: 23986399).

Loading...
||
New chat

Able

正在加载,请稍候...