RBAP48 Monoclonal antibody

• 

  WB analysis using 66060-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66060-1-Ig (RBAP48 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 66060-1-Ig

  WB result of RBAP48 antibody (66060-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RBAP48 transfected HeLa cells.

• 

  WB analysis of HeLa using 66060-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 66060-1-Ig (RBAP48 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 66060-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 66060-1-Ig(RBAP48 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human cervical cancer using 66060-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 66060-1-Ig(RBAP48 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human testis using 66060-1-Ig

  Immunohistochemical analysis of paraffin-embedded human testis using 66060-1-Ig(RBAP48 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 66060-1-Ig

  Immunohistochemical analysis of paraffin-embedded human testis using 66060-1-Ig(RBAP48 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HepG2 using 66060-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 66060-1-Ig (RBAP48 antibody) at dilution of 1:100 and CoraLite488-Conjugated Goat Anti-Mouse IgG(H+L).

• 

  FC experiment of HepG2 using 66060-1-Ig

  1X10^6 HepG2 cells were intracellularly stained with 0.2 ug Anti-Human RBAP48 (66060-1-Ig, Clone:5C4D6) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Mouse IgG2b Isotype Control (66360-3-Ig, Clone: K11B8C4B5) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

RBAP48 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66060-1-Ig

Clone No.5C4D6

Publications(1)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

RBBP4, Nucleosome-remodeling factor subunit RBAP48, Histone-binding protein RBBP4, CAF-I p48, CAF-I 48 kDa subunit

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, NIH/3T3 cells, RAW 264.7 cells, Jurkat cell, ROS1728 cells, HSC-T6 cells, L02 cells
• Positive IHC detected in: human cervical cancer tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66060-1-Ig targets RBAP48 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6196

  Product name: Recombinant human RBBP4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-425 aa of BC053904

  Sequence: MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS

• Full Name: retinoblastoma binding protein 4
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC053904
• Gene Symbol: RBBP4
• Gene ID (NCBI): 5928
• RRID: AB_11064731
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q09028
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Histone-binding protein RBBP4 (also known as RbAp48, or NURF55) is a protein that in humans is encoded by the RBBP4 gene. This gene encodes a ubiquitously expressed nuclear protein that belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2/NuRD complex complex that has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of corepressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. A decrease of RbAp48 in the dentate gyrus (DG) of the hippocampus in the brain is suspected to be a main cause of memory loss in normal aging (PMID: 23986399).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Dev Cell; Nucleoporin Seh1 controls murine neocortical development via transcriptional repression of p21 in neural stem cells; Authors - Wenxiu Dai