RBBP5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RBBP5 Polyclonal antibody, PBS Only (13181-1-PBS)

• 

  WB analysis of HL-60 using 13181-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 13181-1-AP (RBBP5 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

• 

  WB analysis of HL-60 using 13181-1-AP (same clone as 13181-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 13181-1-AP (RBBP5 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13181-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 13181-1-AP (same clone as 13181-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 13181-1-AP (RBBP5 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13181-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 13181-1-AP (same clone as 13181-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 13181-1-AP (RBBP5 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 13181-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 13181-1-AP (same clone as 13181-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 13181-1-AP (RBBP5 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13181-1-PBS in a different storage buffer formulation.

RBBP5 Polyclonal Antibody for WB, ELISA

Cat No. 13181-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

---

Product Information

13181-1-PBS targets RBBP5 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3848

  Product name: Recombinant human RBBP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-327 aa of BC037284

  Sequence: MNLELLESFGQNYPEEADGTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRDQNKVLVCPMKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTDSQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGVVSIWAQNQVE

• Full Name: retinoblastoma binding protein 5
• Calculated Molecular Weight: 538 aa, 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC037284
• Gene Symbol: RBBP5
• Gene ID (NCBI): 5929
• RRID: AB_2177773
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15291
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RBQ-3, also known as RBBP5 (retinoblastoma binding protein 5) or SWD1, is a 538 amino acid protein that localizes to the nucleus and contains six WD repeats. Expressed ubiquitously, RBQ-3 functions as a component of the Set1 complex and preferentially binds to underphosphorylated forms of the retinoblastoma (Rb) protein, possibly playing a role in the regulation of cell proliferation. RBQ-3 exists as two alternatively spliced isoforms and, upon DNA damage, is subject to phosphorylation by ATM or ATR.