CoraLite® Plus 488-conjugated RBBP6 Recombinant monoclonal antibody

• 

  IF Staining of MCF-7 using CL488-85884-5

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using CoraLite® Plus 488 RBBP6 antibody (CL488-85884-5, Clone: 250142C1 ) at dilution of 1:200, CL594-Phalloidin (red).

• 

  IF Staining of Caco-2 using CL488-85884-5

  Immunofluorescent analysis of (4% PFA) fixed Caco-2 cells using CoraLite® Plus 488 RBBP6 antibody (CL488-85884-5, Clone: 250142C1 ) at dilution of 1:200, CL594-Phalloidin (red).

RBBP6 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-85884-5

Clone No.250142C1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

E3 ubiquitin-protein ligase RBBP6, EC:2.3.2.27, MY038, P2P R, P2PR

---

Tested Applications

• Positive IF/ICC detected in: Caco-2 cells, MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85884-5 targets RBBP6 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2484

  Product name: Recombinant human RBBP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-118 aa of BC029352

  Sequence: MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAVCKNTISHFFYTLLLPL

• Full Name: retinoblastoma binding protein 6
• Calculated Molecular Weight: 1792 aa, 200 kDa
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: BC029352
• Gene Symbol: RBBP6
• Gene ID (NCBI): 5930
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q7Z6E9
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

RBBP6 (retinoblastoma binding protein 6) is a multifunctional protein that interacts with both p53 and pRb and has been implicated in mRNA processing. It has also been identified as a putative E3 ubiquitin ligase due to the presence of a RING finger domain [PMID:18851979]. RBBP6 contains an N-terminal ubiquitin-like domain and a cysteine-rich RING finger-like domain, through which it promotes the ubiquitination of p53 by Hdm2 in an E4-like manner [PMID:17470788]. It is implicated in a diverse set of cellular functions, including mRNA metabolism, regulation of the cell cycle, tumorigenesis, and development [PMID:12938151,17470788].