CoraLite® Plus 488-conjugated RBM15B Monoclonal antibody

RBM15B Monoclonal Antibody for FC (Intra)
Cat No. CL488-67506
Clone No.1C2C11

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

FC (Intra)

RBM15B, RNA-binding motif protein 15B, 1C2C11, HsOTT3, HUMAGCGB, HuOTT3, One-twenty two protein 3, OTT3, Putative RNA-binding protein 15B

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells
Positive FC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67506 targets RBM15B in FC (Intra) applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17853

Product name: Recombinant human RBM15B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 490-769 aa of BC001367

Sequence: AKAEETRYPQQYQPSPLPVHYELLTDGYTRHRNLDADLVRDRTPPHLLYSDRDRTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGADGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGSGQQSERGSDRTPERSRKENHSSEGTKESSSNSLSNSRHGAEERGHHHHHHEAADSSHGKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSGSKLTQLKIAQRL

Predict reactive species
Full Name RNA binding motif protein 15B
Calculated Molecular Weight 890 aa, 97 kDa
Observed Molecular Weight 105 kDa
GenBank Accession NumberBC001367
Gene Symbol RBM15B
Gene ID (NCBI) 29890
RRIDAB_2923775
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8NDT2
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RBM15B, one members of the SPEN (Split-end) family of proteins, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components. Present polyclonal anti-RBM15B antibody was produced by immunizing animals with C-terminus of RBM15B, which homolog with a short form of RBM15B(563aa, ~70kDa).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 RBM15B antibody CL488-67506Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...