CoraLite® Plus 488-conjugated RBM25 Recombinant monoclonal antibody

RBM25 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-84968-4
Clone No.242526B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Arg/Glu/Asp-rich protein of 120 kDa, NET52, Protein S164, RBM 25, RED120

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84968-4 targets RBM25 in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18244

Product name: Recombinant human RBM25 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 605-839 aa of BC113389

Sequence: QKPCLKPTLRPISSAPSVSSASGNATPNTPGDESPCGIIIPHENSPDQQQPEEHRPKIGLSLKLGASNSPGQPNSVKRKKLPVDSVFNKFEDEDSDDVPRKRKLVPLDYGEDDKNATKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK

Predict reactive species
Full Name RNA binding motif protein 25
Calculated Molecular Weight 843 aa, 100 kDa
Observed Molecular Weight110-120 kDa
GenBank Accession NumberBC113389
Gene Symbol RBM25
Gene ID (NCBI) 58517
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP49756
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RNA-binding protein 25 (RBM25), also named as Protein S164 or RNPC7, is a 843 amino acid protein, which contains one RRM domain and one PWI domain. RBM25 localizes in the nucleus and cytoplasm. RBM25 acts as a regulator of alternative pre-mRNA splicing and is involved in apoptotic cell death through the regulation of the apoptotic factor BCL2L1 isoform expression.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RBM25 antibody CL488-84968-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...