RBM26 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RBM26 Polyclonal antibody, PBS Only (16823-1-PBS)

• 

  WB analysis using 16823-1-AP (same clone as 16823-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16823-1-AP (RBM26 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16823-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 16823-1-AP (same clone as 16823-1-PBS)

  IP result of anti-RBM26 (IP:16823-1-AP, 4ug; Detection:16823-1-AP 1:5000) with HEK-293 cells lysate 1400 ug. This data was developed using the same antibody clone with 16823-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 16823-1-AP (same clone as 16823-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 16823-1-AP (RBM26 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16823-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 16823-1-AP (same clone as 16823-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 16823-1-AP (RBM26 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16823-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16823-1-AP (same clone as 16823-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using RBM26 antibody 16823-1-AP at 1:100 dilution and FITC-labeled donkey anti-rabbit IgG(green). Blue pseudocolor = DAPI (fluorescent DNA dye). This data was developed using the same antibody clone with 16823-1-PBS in a different storage buffer formulation.

RBM26 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 16823-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

RNA-binding motif protein 26, RBM 26, PRO1777, CTCL tumor antigen se70-2, C13orf10

---

Product Information

16823-1-PBS targets RBM26 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10398

  Product name: Recombinant human RBM26 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 751-1007 aa of BC000791

  Sequence: TQKMLISKLEKNKTMKSEDKAEIMKTLEVLTKNITKLKDEVKAASPGRCLPKSIKTKTQMQKELLDTELDLYKKMQAGEEVTELRRKYTELQLEAAKRGILSSGRGRGIHSRGRGAVHGRGRGRGRGRGVPGHAVVDHRPRALEISAFTESDREDLLPHFAQYGEIEDCQIDDSSLHAVITFKTRAEAEAAAVHGARFKGQDLKLAWNKPVTNISAVETEEVEPDEEEFQEESLVDDSLLQDDDEEEEDNESRSWRR

• Full Name: RNA binding motif protein 26
• Calculated Molecular Weight: 983 aa, 111 kDa
• Observed Molecular Weight: 125 kDa
• GenBank Accession Number: BC000791
• Gene Symbol: RBM26
• Gene ID (NCBI): 64062
• RRID: AB_2175942
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T8P6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.