CoraLite® Plus 488-conjugated RBP5 Monoclonal antibody

RBP5 Monoclonal Antibody for IF/ICC
Cat No. CL488-68126
Clone No.1G7E2

Host / Isotype

Mouse / IgG1

Reactivity

Human, pig

Applications

IF/ICC

CRBP III, CRBP3, CRBPIII, HRBPiso, RBP5, Retinol binding protein 5

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells, A431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68126 targets RBP5 in IF/ICC applications and shows reactivity with Human, pig samples.

Tested Reactivity Human, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24562

Product name: Recombinant human RBP5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-135 aa of BC029355

Sequence: MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR

Predict reactive species
Full Name retinol binding protein 5, cellular
Calculated Molecular Weight 135 aa, 16 kDa
Observed Molecular Weight 16-18 kDa
GenBank Accession NumberBC029355
Gene Symbol RBP5
Gene ID (NCBI) 83758
RRIDAB_3084408
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP82980
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RBP5 (CRBP III) belongs to the fatty-acid binding protein (FABP) family. Human liver and kidney contain the highest levels of CRBP III mRNA, and CRBP III is as a major human intracellular carrier of retinol (PMID:11274389). RBP5 iron response are reversible by genetic complementation. And increased RBP5 expression occurs by a post-transcriptional feedback mechanism whereby RBP5 interacts with its own, and with PAP2 mRNAs. RBP5 is the most significant of the proteins upregulated by iron starvation (PMID:34161395). RBP5 has an estimated molecular mass (15.9 kDa) typical of this protein superfamily (PMID:11274389).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RBP5 antibody CL488-68126Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...