RBP7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RBP7 Polyclonal antibody, PBS Only (14541-1-PBS)

RBP7 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Cat No. 14541-1-PBS Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Synonyms

Cellular retinoic acid-binding protein 4, Cellular retinoic acid-binding protein IV, CRABP IV, CRABP4, CRABP-IV

• 

  WB analysis of HEK-293 using 14541-1-AP (same clone as 14541-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14541-1-AP (RBP7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse adipose using 14541-1-AP (same clone as 14541-1-PBS)

  mouse adipose tissue were subjected to SDS PAGE followed by western blot with 14541-1-AP (RBP7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 14541-1-AP (same clone as 14541-1-PBS)

  IP result of anti-RBP7 (IP:14541-1-AP, 4ug; Detection:14541-1-AP 1:500) with HEK-293 cells lysate 3000ug. This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 14541-1-AP (same clone as 14541-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14541-1-AP (RBP7 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14541-1-AP (same clone as 14541-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 14541-1-AP (RBP7 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14541-1-AP (same clone as 14541-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 14541-1-AP (RBP7 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human kidney using 14541-1-AP (same clone as 14541-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using RBP7 antibody (14541-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human colon cancer using 14541-1-AP (same clone as 14541-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using RBP7 antibody (14541-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 14541-1-AP (same clone as 14541-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using RBP7 antibody (14541-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RBP7 in ?

Chat with Able

---

Product Information

14541-1-PBS targets RBP7 in WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6045

  Product name: Recombinant human RBP7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-134 aa of BC063013

  Sequence: MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

• Full Name: retinol binding protein 7, cellular
• Calculated Molecular Weight: 15.5 kDa
• Observed Molecular Weight: 15-18 kDa
• GenBank Accession Number: BC063013
• Gene Symbol: RBP7
• Gene ID (NCBI): 116362
• RRID: AB_2179293
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96R05
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RBP7(Retinol Binding Protein 7), also known as CRBP4 or CRBP4, belongs to the cell retinol binding protein (CRBP) family. Its structure is a typical β-barrel, which can bind all-trans retinol, but its affinity is lower than other CRBP members. RBP7 is mainly located in cytoplasm, and has secretory characteristics, and is highly expressed in adipose tissue (white/brown), kidney, heart and other tissues. Functionally, it is responsible for the stability and transport of retinol in cells and provides substrates for LRAT to form retinyl esters. At the same time, it is regulated by PPARγ, which promotes preadipocyte differentiation and triglyceride accumulation, and mediates vascular endothelial protection through adiponectin. In terms of diseases, the expression of RBP7 is up-regulated in many hepatocellular carcinoma cell lines, but the level is low in normal hepatocytes L02. As a key chaperone protein of retinol metabolic pathway, RBP7 is a potential target for metabolic diseases and tumor research.