RBP7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RBP7 Polyclonal antibody, PBS Only (14541-1-PBS)

• 

  WB analysis of HEK-293 using 14541-1-AP (same clone as 14541-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14541-1-AP (RBP7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse adipose using 14541-1-AP (same clone as 14541-1-PBS)

  mouse adipose tissue were subjected to SDS PAGE followed by western blot with 14541-1-AP (RBP7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 14541-1-AP (same clone as 14541-1-PBS)

  IP result of anti-RBP7 (IP:14541-1-AP, 4ug; Detection:14541-1-AP 1:500) with HEK-293 cells lysate 3000ug. This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 14541-1-AP (same clone as 14541-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14541-1-AP (RBP7 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14541-1-AP (same clone as 14541-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 14541-1-AP (RBP7 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14541-1-AP (same clone as 14541-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 14541-1-AP (RBP7 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human kidney using 14541-1-AP (same clone as 14541-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using RBP7 antibody (14541-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human colon cancer using 14541-1-AP (same clone as 14541-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using RBP7 antibody (14541-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 14541-1-AP (same clone as 14541-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using RBP7 antibody (14541-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14541-1-PBS in a different storage buffer formulation.

RBP7 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Cat No. 14541-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Synonyms

CRBP4, CRABP-IV, CRABP4, CRABP IV, Cellular retinoic acid-binding protein IV

---

Product Information

14541-1-PBS targets RBP7 in WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6045

  Product name: Recombinant human RBP7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-134 aa of BC063013

  Sequence: MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

• Full Name: retinol binding protein 7, cellular
• Calculated Molecular Weight: 15.5 kDa
• Observed Molecular Weight: 15-18 kDa
• GenBank Accession Number: BC063013
• Gene Symbol: RBP7
• Gene ID (NCBI): 116362
• RRID: AB_2179293
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96R05
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.