RBPMS2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RBPMS2 Polyclonal antibody, PBS Only (32971-1-PBS)

• 

  WB analysis using 32971-1-AP (same clone as 32971-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32971-1-AP (RBPMS2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32971-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 32971-1-AP (same clone as 32971-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32971-1-AP (RBPMS2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32971-1-PBS in a different storage buffer formulation.

RBPMS2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32971-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

RNA binding protein, mRNA processing factor 2, RNA-binding protein with multiple splicing 2

---

Product Information

32971-1-PBS targets RBPMS2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37616

  Product name: Recombinant human RBPMS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 115-207 aa of NM_194272

  Sequence: SKLMATPNPSNVHPALGAHFIARDPYDLMGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRWYPSSDTTQQGWKYRQFC

• Full Name: RNA binding protein with multiple splicing 2
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 24 kDa, 26-29 kDa
• GenBank Accession Number: NM_194272
• Gene Symbol: RBPMS2
• Gene ID (NCBI): 348093
• RRID: AB_3742809
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6ZRY4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RBPMS2 (RNA binding protein with multiple splicing 2) is an RNA binding protein, and its encoded protein is rich in RNA binding motifs, belonging to the family of RNA binding motifs, and has an RNA recognition motif (RRM) domain, which can bind with RNA molecules and participate in RNA regulation. RBPMS2 is abundant in myocardial cells and plays an important role in the development and function of myocardium. It can regulate the differentiation and proliferation of myocardial cells and maintain the normal function of myocardial cells. In gastric cancer, the expression level of RBPMS2 is related to lymph node metastasis, which can be used as a biomarker to predict the prognosis of gastric cancer.