REEP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• REEP2 Polyclonal antibody, PBS Only (15684-1-PBS)

• 

  WB analysis using 15684-1-AP (same clone as 15684-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15684-1-AP (REEP2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15684-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse eye using 15684-1-AP (same clone as 15684-1-PBS)

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 15684-1-AP (REEP2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15684-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 15684-1-AP (same clone as 15684-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 15684-1-AP (REEP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15684-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 15684-1-AP (same clone as 15684-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15684-1-AP (REEP2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15684-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 15684-1-AP (same clone as 15684-1-PBS)

  IP result of anti-REEP2 (IP:15684-1-AP, 4ug; Detection:15684-1-AP 1:5000) with mouse brain tissue lysate 1680 ug. This data was developed using the same antibody clone with 15684-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15684-1-AP (same clone as 15684-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15684-1-AP (REEP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15684-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15684-1-AP (same clone as 15684-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15684-1-AP (REEP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15684-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 15684-1-AP (same clone as 15684-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 15684-1-AP (REEP2 antibody) at dilution of 1:50 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15684-1-PBS in a different storage buffer formulation.

• 

  FC experiment of SH-SY5Y using 15684-1-AP (same clone as 15684-1-PBS)

  1x10^6 SH-SY5Y cells were intracellularly stained with 0.4 ug REEP2 Polyclonal antibody (15684-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 15684-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

REEP2 Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), IP, Indirect ELISA

Cat No. 15684-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), IP, Indirect ELISA

Synonyms

C5orf19, Receptor expression-enhancing protein 2, SGC32445

---

Product Information

15684-1-PBS targets REEP2 in WB, IHC, IF-P, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8186

  Product name: Recombinant human REEP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 70-252 aa of BC006218

  Sequence: IAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA

• Full Name: receptor accessory protein 2
• Calculated Molecular Weight: 252 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC006218
• Gene Symbol: REEP2
• Gene ID (NCBI): 51308
• RRID: AB_2238326
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRK0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.