Tested Applications
| Positive WB detected in | HeLa cells, mouse heart tissue, rat heart tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14643-1-AP targets REEP5 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, monkey, xenopus |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6229 Product name: Recombinant human REEP5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-189 aa of BC065926 Sequence: MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST Predict reactive species |
| Full Name | receptor accessory protein 5 |
| Calculated Molecular Weight | 21 kDa |
| Observed Molecular Weight | 18-21 kDa |
| GenBank Accession Number | BC065926 |
| Gene Symbol | REEP5 |
| Gene ID (NCBI) | 7905 |
| RRID | AB_2178440 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q00765 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
REEP5 (receptor expression-enhancing protein 5), also named as C5orf18, DP1 or TB2, is a membrane protein belonging to DP1/Yop1p protein family. All REEP proteins contain a conserved TB2/DP1, HVA22 domain which is involved in intracellular trafficking and secretion (PMID: 19123125). REEP5 is expressed in circumvallate papillae and testis, and may have the function to influence functional cell surface expression of taste receptors (PMID: 16720576). REEP5 can interact with atlastins (ATL1 and ATL2) which are involved in modulating the structure of ER network (PMID: 19665976).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for REEP5 antibody 14643-1-AP | Download protocol |
| IF protocol for REEP5 antibody 14643-1-AP | Download protocol |
| IHC protocol for REEP5 antibody 14643-1-AP | Download protocol |
| IP protocol for REEP5 antibody 14643-1-AP | Download protocol |
| WB protocol for REEP5 antibody 14643-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
RETICULON 3 (RTN3) antibody, catalog number 14643-1-AP, has accumulated 63 citations across high-impact journals including Nature, Cell, Nature Communications, Molecular Cell, Developmental Cell, Autophagy, eLife, EMBO Journal, and Current Biology. Associated research fields span endoplasmic reticulum (ER) morphology and remodeling, ER-phagy/reticulophagy, selective autophagy, lipid metabolism, neurodegeneration (Alzheimer's disease, hereditary spastic paraplegia), cardiomyopathy, viral pathogenesis, and cancer biology.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Targeting intracellular cholesterol imbalance rescues sarcomere-ER contact site signaling and ER remodeling in dilated cardiomyopathy. | ||
Reviews
What customers say
All five reviewers report strong, specific performance. Western blot users consistently observe a single sharp band at the expected ~20–21 kDa with clean background across HeLa, HEK293T, HCT116, and mouse heart tissue. One immunofluorescence user confirms ER-like localization in mouse cardiomyocytes. Sensitivity is a recurring highlight, with one reviewer noting excellent results at 1:3000 dilution using only 1 hour incubation. Overall ratings average 4.8 out of 5 stars.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Andrea (Verified Customer) (05-10-2022) | Sharp and strong signal at 21 kDa with clear background.
![]() |
Christine (Verified Customer) (11-10-2021) | Very good detection of endogenous REEP5 protein in human HEK293T and HeLa cell lines. Band at about 20 kDa (expected size for REEP5)
|
Wei (Verified Customer) (09-22-2020) | The antibody gets sharp, single band on western blot.
|
WEI (Verified Customer) (06-29-2020) | The staining pattern is consistent with cardiomyocytes like ER localization.
|
H (Verified Customer) (04-05-2020) | The antibody is very sensitive, such that 1 hour incubation using 1:3000 dilution worked perfectly.
![]() |















