Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

REEP5 Polyclonal antibody

REEP5 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

C5orf18, DP1, Polyposis locus protein 1, Protein TB2, Receptor expression-enhancing protein 5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for REEP5 in ?

Tested Applications

Positive WB detected inHeLa cells, mouse heart tissue, rat heart tissue
Positive IP detected inHeLa cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:300-1:1200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14643-1-AP targets REEP5 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, monkey, xenopus
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6229

Product name: Recombinant human REEP5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-189 aa of BC065926

Sequence: MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

Predict reactive species
Full Name receptor accessory protein 5
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 18-21 kDa
GenBank Accession NumberBC065926
Gene Symbol REEP5
Gene ID (NCBI) 7905
RRIDAB_2178440
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ00765
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

REEP5 (receptor expression-enhancing protein 5), also named as C5orf18, DP1 or TB2, is a membrane protein belonging to DP1/Yop1p protein family. All REEP proteins contain a conserved TB2/DP1, HVA22 domain which is involved in intracellular trafficking and secretion (PMID: 19123125). REEP5 is expressed in circumvallate papillae and testis, and may have the function to influence functional cell surface expression of taste receptors (PMID: 16720576). REEP5 can interact with atlastins (ATL1 and ATL2) which are involved in modulating the structure of ER network (PMID: 19665976).

Protocols

Product Specific Protocols
FC protocol for REEP5 antibody 14643-1-APDownload protocol
IF protocol for REEP5 antibody 14643-1-APDownload protocol
IHC protocol for REEP5 antibody 14643-1-APDownload protocol
IP protocol for REEP5 antibody 14643-1-APDownload protocol
WB protocol for REEP5 antibody 14643-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

RETICULON 3 (RTN3) antibody, catalog number 14643-1-AP, has accumulated 63 citations across high-impact journals including Nature, Cell, Nature Communications, Molecular Cell, Developmental Cell, Autophagy, eLife, EMBO Journal, and Current Biology. Associated research fields span endoplasmic reticulum (ER) morphology and remodeling, ER-phagy/reticulophagy, selective autophagy, lipid metabolism, neurodegeneration (Alzheimer's disease, hereditary spastic paraplegia), cardiomyopathy, viral pathogenesis, and cancer biology.

SpeciesApplicationTitle
humanWB

Signal Transduct Target Ther

Targeting intracellular cholesterol imbalance rescues sarcomere-ER contact site signaling and ER remodeling in dilated cardiomyopathy.

Authors - Nadezda Ignatyeva
humanIF

Nature

Secretome translation shaped by lysosomes and lunapark-marked ER junctions

Authors - Heejun Choi
humanWB

Nature

ER proteins decipher the tubulin code to regulate organelle distribution

Authors - Pengli Zheng
mouse,humanWB

Nature

Heteromeric clusters of ubiquitinated ER-shaping proteins drive ER-phagy

Authors - Hector Foronda
humanWB,IF

Nature

Ubiquitination regulates ER-phagy and remodelling of endoplasmic reticulum

Authors - Alexis González
human, mouseWB

Nature

CLCC1 governs ER bilayer equilibration to maintain lipid homeostasis.

Authors - Lingzhi Wu

Reviews

    4.8 out of 5
Add a review

5 verified customer reviews

What customers say

All five reviewers report strong, specific performance. Western blot users consistently observe a single sharp band at the expected ~20–21 kDa with clean background across HeLa, HEK293T, HCT116, and mouse heart tissue. One immunofluorescence user confirms ER-like localization in mouse cardiomyocytes. Sensitivity is a recurring highlight, with one reviewer noting excellent results at 1:3000 dilution using only 1 hour incubation. Overall ratings average 4.8 out of 5 stars.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Andrea (Verified Customer) (05-10-2022)

Sharp and strong signal at 21 kDa with clear background.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: HeLa cell line
REEP5 Antibody Western Blot validation (1:250 dilution) in HeLa cell line (Cat no:14643-1-AP)

Christine (Verified Customer) (11-10-2021)

Very good detection of endogenous REEP5 protein in human HEK293T and HeLa cell lines. Band at about 20 kDa (expected size for REEP5)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Cell culture of HeLa and HEK293T

Wei (Verified Customer) (09-22-2020)

The antibody gets sharp, single band on western blot.

  • Applications: Western Blot
  • Cell Tissue Type: Mouse heart

WEI (Verified Customer) (06-29-2020)

The staining pattern is consistent with cardiomyocytes like ER localization.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: Mouse Heart

H (Verified Customer) (04-05-2020)

The antibody is very sensitive, such that 1 hour incubation using 1:3000 dilution worked perfectly.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: HEK293T and HCT116
REEP5 Antibody Western Blot validation (1:3000 dilution) in HEK293T and HCT116 (Cat no:14643-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...