REEP5 Monoclonal antibody

• 

  WB analysis using 68119-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68119-1-Ig (REEP5 antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis of HeLa using 68119-1-Ig

  WB result of REEP5 antibody (68119-1-Ig; 1:60000; incubated at room temperature for 1.5 hours) with sh-Control and sh-REEP5 transfected HeLa cells.

• 

  WB analysis of pig heart using 68119-1-Ig

  pig heart tissue were subjected to SDS PAGE followed by western blot with 68119-1-Ig (REEP5 antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 68119-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 68119-1-Ig (REEP5 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 68119-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 68119-1-Ig (REEP5 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 68119-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 68119-1-Ig (REEP5 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 68119-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using REEP5 antibody (68119-1-Ig, Clone: 1H8D8 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

REEP5 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 68119-1-Ig

Clone No.1H8D8

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1H8D8, C5orf18, DP1, Polyposis locus protein 1, Protein TB2

---

Tested Applications

• Positive WB detected in: HEK-293 cells, pig heart tissue, HeLa cells, LNCaP cells, Jurkat cells, MOLT-4 cells, K-562 cells
• Positive IHC detected in: human colon cancer tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:100000
• Immunohistochemistry (IHC): IHC : 1:5000-1:20000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68119-1-Ig targets REEP5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6229

  Product name: Recombinant human REEP5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-189 aa of BC065926

  Sequence: MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

• Full Name: receptor accessory protein 5
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC065926
• Gene Symbol: REEP5
• Gene ID (NCBI): 7905
• RRID: AB_2923648
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q00765
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

REEP5 (receptor expression-enhancing protein 5), also named as C5orf18, DP1 or TB2, is a membrane protein belonging to DP1/Yop1p protein family. All REEP proteins contain a conserved TB2/DP1, HVA22 domain which is involved in intracellular trafficking and secretion (PMID: 19123125). REEP5 is expressed in circumvallate papillae and testis, and may have the function to influence functional cell surface expression of taste receptors (PMID: 16720576). REEP5 can interact with atlastins (ATL1 and ATL2) which are involved in modulating the structure of ER network (PMID: 19665976).